A biphenyl inhibitor of eIF4E targeting an internal binding site enables the design of cell-permeable PROTAC-degraders. Determined by X-ray diffraction at 1.91 Å resolution. Released 28 Apr 2021.
Explore 7MEU in 3D Show helices and sheets RCSB PDB PDBe
7MEU contains 17 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-49 | 12 | 1 |
| α-helix | 56-59 | 4 | |
| β-strand | 62-68 | 7 | 1 |
| α-helix | 69-82 | 14 | |
| β-strand | 89-95 | 7 | 1 |
| α-helix | 105-108 | 4 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 123-138 | 16 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 162-167 | 6 | 1 |
| α-helix | 173-186 | 14 | |
| β-strand | 196-199 | 4 | 1 |
| α-helix | 200-204 | 5 | |
| β-strand | 215-216 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37 | 1 | |
| β-strand | 38-49 | 12 | 2 |
| α-helix | 56-59 | 4 | |
| β-strand | 60-68 | 9 | 2 |
| α-helix | 69-76 | 8 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 89-95 | 7 | 2 |
| β-strand | 111-117 | 7 | 2 |
| α-helix | 119-138 | 20 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-156 | 8 | 2 |
| β-strand | 161-167 | 7 | 2 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 2 |
| α-helix | 200-204 | 5 | |
| α-helix | 211-213 | 3 | |
| β-strand | 215-216 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 4E | A, B | protein | 192 | Homo sapiens | P06730 (AlphaFold model) |
>7MEU_1 Eukaryotic translation initiation factor 4E (chains A, B) MEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNL MPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDY SDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTAT KSGSTTKNRFVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| MGP | 7-methyl-guanosine-5'-triphosphate | C11 H19 N5 O14 P3 | 2 |
| Z5D | (2E)-2-{2-[4-([1,1'-biphenyl]-4-yl)-1,3-thiazol-2-yl]hydrazinylidene}-3-(2-nitr… | C24 H18 N4 O4 S | 1 |
A biphenyl inhibitor of eIF4E targeting an internal binding site enables the design of cell-permeable PROTAC-degraders. Fischer, P.D., Papadopoulos, E., Dempersmier, J.M. et al. Eur J Med Chem (2021) 219:113435-113435. DOI 10.1016/j.ejmech.2021.113435 · PubMed
Other PDB entries of the same protein (UniProt P06730 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MEU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.