7MGW: Sodium-dependent serotonin transporter

5-HT bound serotonin transporter reconstituted in lipid nanodisc in NaCl in occluded conformation. Determined by electron microscopy at 3.5 Å resolution. Released 15 Dec 2021.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 6,223
Mol. weight: 88.13 kDa
Ligands: D10, HP6, LNK, D12
Released: 15 Dec 2021

Explore 7MGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MGW contains 35 α-helices and 31 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	85-96	12
α-helix	99-112	14
α-helix	115-117	3
α-helix	119-121	3
α-helix	122-143	22
α-helix	149-151	3
α-helix	156-158	3
α-helix	161-189	29
β-strand	209	1	1
β-strand	225	1	1
α-helix	227-234	8
α-helix	239-241	3
α-helix	253-272	20
α-helix	274-283	10
α-helix	286-299	14
α-helix	307-312	6
α-helix	326-337	12
α-helix	343-348	6
α-helix	357-390	34
α-helix	394-396	3
α-helix	404-416	13
α-helix	423-453	31
α-helix	455-460	6
α-helix	462-481	20
α-helix	486-495	10
α-helix	499-510	12
α-helix	511-515	5
α-helix	518-529	12
α-helix	537-539	3
α-helix	540-544	5
α-helix	545-558	14
β-strand	564	1	2
β-strand	569	1	2
α-helix	570-571	2
α-helix	572-584	13
α-helix	588-599	12
α-helix	604-611	8

Chain B: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	3
β-strand	29	1	4
β-strand	38-42	5	3
β-strand	53-58	6	5
β-strand	64-71	8	5
β-strand	76-79	4	5
β-strand	87-92	6	3
β-strand	97-102	6	3
β-strand	112-113	2	5
β-strand	116-117	2	5
β-strand	129	1	5
β-strand	134-135	2	5
β-strand	136	1	4

Chain C: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	25-27	3	6
β-strand	30-31	2	7
α-helix	33-34	2
β-strand	39-44	6	6
β-strand	50-51	2	8
β-strand	54-55	2	8
β-strand	58-62	5	9
α-helix	67-68	2
β-strand	69-73	5	9
β-strand	77-78	2	9
β-strand	86	1	6
β-strand	89-91	3	6
β-strand	94-99	6	6
β-strand	109-114	6	9
β-strand	121-122	2	9
β-strand	127-128	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium-dependent serotonin transporter	A	protein	537	Homo sapiens	P31645 (AlphaFold model)
variable domain of 15B8 antibody Fab heavy chain	B	protein	118	Mus musculus
variable domain of 15B8 antiboty Fab light chain	C	protein	110	Mus musculus

Sequence of entity 1 (A), FASTA

>7MGW_1 Sodium-dependent serotonin transporter (chains A)
RETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELA
LGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWT
SCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALC
IMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQ
KLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFV
IFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDS
TFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATG
PAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLM
SPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPE

Sequence of entity 2 (B), FASTA

>7MGW_2 variable domain of 15B8 antibody Fab heavy chain (chains B)
QVQLQQSGPELVKLGASVRISCKASGYRFSYSWMNWVKQRPGKGLEWIGRIYPGDGDTKY
SGKFKGKATLTADKSSSTVYMQLSSLTSEDSAVYFCARSAYGSEGFAMDYWGQGTSVT

Sequence of entity 3 (C), FASTA

>7MGW_3 variable domain of 15B8 antiboty Fab light chain (chains C)
DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFLNWFQQKPGQPPKLLIYAASNQGS
GVPARFSGSGSGTYFSLNIHPMEEDDTAVYFCQQTKGVSWTFGGGTKVEI

Ligands and cofactors

ID	Name	Formula	Copies
D10	Decane	C10 H22	1
HP6	Heptane	C7 H16	6
LNK	Pentane	C5 H12	1
D12	Dodecane	C12 H26	4
CLR	Cholesterol	C27 H46 O	1
SRO	Serotonin	C10 H12 N2 O	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Illumination of serotonin transporter mechanism and role of the allosteric site. Yang, D., Gouaux, E. Sci Adv (2021) 7:eabl3857-eabl3857. DOI 10.1126/sciadv.abl3857 · PubMed

Other PDB entries of the same protein (UniProt P31645 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HCO 2.78 Å, Outward-open structure of human serotonin transporter bound to vilazodone
7TXT 3.0 Å, Structure of human serotonin transporter bound to small molecule '8090 in lipid nanodisc…
5I6X 3.14 Å, X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the…
5I71 3.15 Å, X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at…
9VWS 3.2 Å, Cryo-EM structure of human serotonin transporter in complex with tesofensine
5I73 3.24 Å, X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at…
9IY7 3.27 Å, Cryo-EM structure of the wild-type human serotonin transporter complexed with S-ketamine
6VRH 3.3 Å, Cryo-EM structure of the wild-type human serotonin transporter complexed with paroxetine…
7LIA 3.3 Å, 5-HT bound serotonin transporter reconstituted in lipid nanodisc in presence of NaCl in…
5I74 3.4 Å, X-ray structure of the ts3 human serotonin transporter complexed with Br-citalopram at…
9PNS 3.4 Å, Structure of human serotonin transporter bound to small molecule zPZd in lipid nanodisc…
5I75 3.49 Å, X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at…

Browse structure collections

About this viewer

MolViewer shows 7MGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.