7MHY: Human Hedgehog acyltransferase
Human Hedgehog acyltransferase (HHAT) in complex with palmitoyl-CoA and two Fab antibody fragments. Determined by electron microscopy at 2.7 Å resolution. Released 16 Jun 2021.
- Method
- Electron microscopy
- Resolution
- 2.7 Å
- Organisms
- Homo sapiens, Mus musculus
- Chains
- 5
- Atoms
- 7,904
- Mol. weight
- 170.05 kDa
- Ligands
- AJP, PKZ, HEM
- Released
- 16 Jun 2021
Explore 7MHY in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7MHY contains 34 α-helices and 51 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 31 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-27 | 24 | |
| α-helix | 33-37 | 5 | |
| β-strand | 42-44 | 3 | 1 |
| β-strand | 52-54 | 3 | 1 |
| α-helix | 59-66 | 8 | |
| α-helix | 67-71 | 5 | |
| α-helix | 72-88 | 17 | |
| α-helix | 93-128 | 36 | |
| α-helix | 133-147 | 15 | |
| α-helix | 150-157 | 8 | |
| α-helix | 164-189 | 26 | |
| α-helix | 196-198 | 3 | |
| α-helix | 201-208 | 8 | |
| α-helix | 211-213 | 3 | |
| α-helix | 217-219 | 3 | |
| α-helix | 222-229 | 8 | |
| α-helix | 237-264 | 28 | |
| α-helix | 267-271 | 5 | |
| α-helix | 274-277 | 4 | |
| α-helix | 282-314 | 33 | |
| α-helix | 318-324 | 7 | |
| α-helix | 325-327 | 3 | |
| α-helix | 331-337 | 7 | |
| α-helix | 340-346 | 7 | |
| α-helix | 347-351 | 5 | |
| α-helix | 352-354 | 3 | |
| α-helix | 361-378 | 18 | |
| α-helix | 383-406 | 24 | |
| α-helix | 409-418 | 10 | |
| α-helix | 421-448 | 28 | |
| α-helix | 450-460 | 11 | |
| α-helix | 465-469 | 5 | |
| α-helix | 470-487 | 18 | |
Chain M: 1 helix, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 22-25 | 4 | 2 |
| β-strand | 29-31 | 3 | 3 |
| β-strand | 37-44 | 8 | 2 |
| β-strand | 53-58 | 6 | 3 |
| β-strand | 64-70 | 7 | 3 |
| β-strand | 77-79 | 3 | 3 |
| β-strand | 87-92 | 6 | 2 |
| β-strand | 97-102 | 6 | 2 |
| α-helix | 107-109 | 3 | |
| β-strand | 111-118 | 8 | 3 |
| β-strand | 125-128 | 4 | 3 |
| β-strand | 132-136 | 5 | 3 |
Chain N: 0 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 23-26 | 4 | 4 |
| β-strand | 29-31 | 3 | 5 |
| β-strand | 38-44 | 7 | 4 |
| β-strand | 49 | 1 | 6 |
| β-strand | 55 | 1 | 6 |
| β-strand | 57-62 | 6 | 5 |
| β-strand | 69-73 | 5 | 5 |
| β-strand | 77-78 | 2 | 5 |
| β-strand | 86-90 | 5 | 4 |
| β-strand | 94-99 | 6 | 4 |
| β-strand | 109-114 | 6 | 5 |
| β-strand | 121-122 | 2 | 5 |
| β-strand | 126-129 | 4 | 5 |
Chain O: 1 helix, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 22-25 | 4 | 7 |
| β-strand | 29 | 1 | 8 |
| β-strand | 39-44 | 6 | 7 |
| β-strand | 53-58 | 6 | 9 |
| β-strand | 64-70 | 7 | 9 |
| β-strand | 77-79 | 3 | 9 |
| α-helix | 81-83 | 3 | |
| β-strand | 89-91 | 3 | 7 |
| β-strand | 99-102 | 4 | 7 |
| β-strand | 112-118 | 7 | 9 |
| β-strand | 125-128 | 4 | 9 |
| β-strand | 132-133 | 2 | 9 |
| β-strand | 134 | 1 | 8 |
Chain P: 1 helix, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 23-26 | 4 | 10 |
| β-strand | 29-30 | 2 | 11 |
| β-strand | 40-44 | 5 | 10 |
| β-strand | 49 | 1 | 12 |
| β-strand | 55 | 1 | 12 |
| β-strand | 57-62 | 6 | 11 |
| β-strand | 68-72 | 5 | 11 |
| β-strand | 74 | 1 | 13 |
| β-strand | 77 | 1 | 13 |
| β-strand | 95-97 | 3 | 10 |
| β-strand | 109-114 | 6 | 11 |
| α-helix | 120 | 1 | |
| β-strand | 121-122 | 2 | 11 |
| β-strand | 126-128 | 3 | 11 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein-cysteine N-palmitoyltransferase HHAT | A | protein | 493 | Homo sapiens | Q5VTY9 (AlphaFold model) |
| 1C06 Fab heavy chain | M | protein | 211 | Mus musculus | |
| 1C06 Fab light chain | N | protein | 207 | Mus musculus | |
| 3H02 Fab heavy chain | O | protein | 211 | Mus musculus | |
| 3H02 Fab light chain | P | protein | 207 | Mus musculus | |
Sequence of entity 1 (A), FASTA
>7MHY_1 Protein-cysteine N-palmitoyltransferase HHAT (chains A)
MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEW
SFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLH
TTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYY
TSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKAS
LCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY
LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHG
LLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS
PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYS
HVGIAWAQTYATD
Sequence of entity 2 (M), FASTA
>7MHY_2 1C06 Fab heavy chain (chains M)
MERHWIFLFLFSVTAGVHSQVQLRQSGAELAKPGASVKMSCKASGYTFTNYWLHWIKQRP
GQGLEWIGYISPNTGSTEYSQKFKDRATLTADKSSSTAYMQLSSLTSEDSAVYYCAGSRI
TGTWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSS
Sequence of entity 3 (N), FASTA
>7MHY_3 1C06 Fab light chain (chains N)
MKLPVRLLVLMFWIPASRSDVLMTQTPLSLPVSLGDQVSISCRSSQSIVHSNGNTYLEWY
LQKPGQSPKLLIYWVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPW
TFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTK
Sequence of entity 4 (O), FASTA
>7MHY_4 3H02 Fab heavy chain (chains O)
MDWLWNLLFLMAAAQSAQAQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVRQAP
GKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKDEDMATYFCARVWN
YDYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSS
Sequence of entity 5 (P), FASTA
>7MHY_5 3H02 Fab light chain (chains P)
MKLPVRLLVLMFWIPASRSDVLMTQTPLSLPVSLGDQVSISCRSSQSIVHSNGNTYLEWY
LQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPW
TFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| AJP | Digitonin | C56 H92 O29 | 14 |
| PKZ | Palmitoyl-CoA | C37 H66 N7 O17 P3 S | 3 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
Primary citation
Substrate and product complexes reveal mechanisms of Hedgehog acylation by HHAT. Jiang, Y., Benz, T.L., Long, S.B. Science (2021) 372:1215-1219. DOI 10.1126/science.abg4998 · PubMed
Other PDB entries of the same protein (UniProt Q5VTY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6UJO 2.25 Å, HHAT L75F Neoantigen Peptide KQWLVWLFL Presented by HLA-A206
- 6UJQ 2.55 Å, HHAT Wild Type Peptide KQWLVWLLL Presented by HLA-A206
- 6UK4 2.7 Å, Complex of T cell Receptor with HHAT Neoantigen Peptide KQWLVWLFL Presented by HLA-A206
- 7Q1U 2.7 Å, Structure of Hedgehog acyltransferase (HHAT) in complex with megabody 177 bound to…
- 7URF 2.8 Å, Human HHAT H379C in complex with SHH N-terminal peptide
- 6P64 3.05 Å, Alpha-beta TCR Binding to Neoantigen KQWLVWLFL Presented by HLA-A206
- 6UK2 3.14 Å, Complex of T cell Receptor with HHAT Wild Type Peptide KQWLVWLLL Presented by HLA-A206
- 7MHZ 3.2 Å, Human Hedgehog acyltransferase (HHAT) in complex with a palmitoylated Hedgehog peptide…
- 7Q6Z 3.59 Å, Structure of Hedgehog acyltransferase (HHAT) in complex with megabody 177 bound to…
Browse structure collections
About this viewer
MolViewer shows 7MHY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.