7URF: Human HHAT H379C

Human HHAT H379C in complex with SHH N-terminal peptide. Determined by electron microscopy at 2.8 Å resolution. Released 20 Jul 2022.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 6,133
Mol. weight: 121.27 kDa
Ligands: HEM, PKZ, AJP
Released: 20 Jul 2022

Explore 7URF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7URF contains 34 α-helices and 26 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-27	24
α-helix	33-39	7
α-helix	41-42	2
β-strand	43	1	1
β-strand	53	1	1
α-helix	58-66	9
α-helix	67-71	5
α-helix	72-88	17
α-helix	93-128	36
α-helix	133-148	16
α-helix	150-159	10
α-helix	165-189	25
α-helix	193-195	3
α-helix	201-208	8
α-helix	211-213	3
α-helix	222-228	7
α-helix	237-264	28
α-helix	267-272	6
α-helix	274-277	4
α-helix	282-314	33
α-helix	318-324	7
α-helix	325-327	3
α-helix	331-337	7
α-helix	340-346	7
α-helix	347-351	5
α-helix	352-354	3
α-helix	360-379	20
α-helix	383-406	24
α-helix	409-418	10
α-helix	421-447	27
α-helix	450-457	8
α-helix	458-462	5
α-helix	465-469	5
α-helix	470-487	18

Chain O: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	22-25	4	2
β-strand	29-30	2	3
β-strand	36-44	9	2
α-helix	48-50	3
β-strand	53-58	6	4
β-strand	64-70	7	4
β-strand	77-79	3	4
β-strand	88-91	4	2
β-strand	99-105	7	2
β-strand	112-118	7	4
β-strand	125-128	4	4
β-strand	132-133	2	4
β-strand	134-135	2	3

Chain P: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	5
β-strand	29-32	4	6
β-strand	38-43	6	5
β-strand	49	1	7
β-strand	55	1	7
β-strand	57-62	6	6
β-strand	69-72	4	6
β-strand	88-90	3	5
β-strand	94-99	6	5
β-strand	109-114	6	6
α-helix	120	1
β-strand	121-122	2	6
β-strand	126-130	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein-cysteine N-palmitoyltransferase HHAT	A	protein	500	Homo sapiens	Q5VTY9 (AlphaFold model)
SHH-N peptide	B	protein	7	Homo sapiens	Q15465 (AlphaFold model)
3H02 heavy chain	O	protein	250	Mus musculus
3H02 light chain	P	protein	239	Mus musculus

Sequence of entity 1 (A), FASTA

>7URF_1 Protein-cysteine N-palmitoyltransferase HHAT (chains A)
MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEW
SFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLH
TTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYY
TSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKAS
LCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY
LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHG
LLGTLFSTAMTFAFVSYWCGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS
PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYS
HVGIAWAQTYATDDYKDDDK

Sequence of entity 2 (B), FASTA

>7URF_2 SHH-N peptide (chains B)
CGPGRGF

Sequence of entity 3 (O), FASTA

>7URF_3 3H02 heavy chain (chains O)
MGWSCIILFLVATATGVHSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVRQAP
GKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKDEDMATYFCARVWN
YDYYFDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
CDKTHHHHHH

Sequence of entity 4 (P), FASTA

>7URF_4 3H02 light chain (chains P)
MGWSCIILFLVATARTGVHSDVLMTQTPLSLPVSLGDQVSISCRSSQSIVHSNGNTYLEW
YLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP
WTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1
PKZ	Palmitoyl-CoA	C37 H66 N7 O17 P3 S	2
AJP	Digitonin	C56 H92 O29	5

Primary citation

Mechanisms and inhibition of Porcupine-mediated Wnt acylation. Liu, Y., Qi, X., Donnelly, L. et al. Nature (2022) 607:816-822. DOI 10.1038/s41586-022-04952-2 · PubMed

Other PDB entries of the same protein (UniProt Q5VTY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UJO 2.25 Å, HHAT L75F Neoantigen Peptide KQWLVWLFL Presented by HLA-A206
6UJQ 2.55 Å, HHAT Wild Type Peptide KQWLVWLLL Presented by HLA-A206
6UK4 2.7 Å, Complex of T cell Receptor with HHAT Neoantigen Peptide KQWLVWLFL Presented by HLA-A206
7MHY 2.7 Å, Human Hedgehog acyltransferase (HHAT) in complex with palmitoyl-CoA and two Fab antibody…
7Q1U 2.7 Å, Structure of Hedgehog acyltransferase (HHAT) in complex with megabody 177 bound to…
6P64 3.05 Å, Alpha-beta TCR Binding to Neoantigen KQWLVWLFL Presented by HLA-A206
6UK2 3.14 Å, Complex of T cell Receptor with HHAT Wild Type Peptide KQWLVWLLL Presented by HLA-A206
7MHZ 3.2 Å, Human Hedgehog acyltransferase (HHAT) in complex with a palmitoylated Hedgehog peptide…
7Q6Z 3.59 Å, Structure of Hedgehog acyltransferase (HHAT) in complex with megabody 177 bound to…

Browse structure collections

About this viewer

MolViewer shows 7URF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.