Crystal structure of the SARS-CoV-2 ORF8 accessory protein. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 Jan 2023.
Explore 7MX9 in 3D Show helices and sheets RCSB PDB PDBe
7MX9 contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-25 | 6 | 1 |
| β-strand | 30-32 | 3 | 2 |
| α-helix | 38 | 1 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 57-60 | 4 | 1 |
| β-strand | 80-83 | 4 | 2 |
| β-strand | 86-89 | 4 | 2 |
| β-strand | 98-103 | 6 | 1 |
| β-strand | 112-120 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ORF8 protein | A | protein | 113 | Severe acute respiratory syndrome coronavirus 2 | P0DTC8 (AlphaFold model) |
>7MX9_1 ORF8 protein (chains A) GVRLASAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSK SPIQYIDIGQYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
The unique ORF8 protein of SARS-CoV-2 binds to human dendritic cells and induces a cytokine storm. Hamdorf, M., Imhof, T., Theobald, S.J. et al. To be published.
Other PDB entries of the same protein (UniProt P0DTC8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MX9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.