7MYX: PH domain (R86A) of Akt1

Crystal structure of the PH domain (R86A) of Akt1. Determined by X-ray diffraction at 1.39 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 1.39 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,069
Mol. weight: 14.46 kDa
Released: 9 Nov 2022

Explore 7MYX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MYX contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6-15	10	1
α-helix	16	1
β-strand	22-30	9	1
β-strand	34-38	5	1
β-strand	53-56	4	1
β-strand	61-65	5	1
β-strand	72-79	8	1
β-strand	82-89	8	1
α-helix	93-118	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RAC-alpha serine/threonine-protein kinase	A	protein	121	Homo sapiens	P31749 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7MYX_1 RAC-alpha serine/threonine-protein kinase (chains A)
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIEATFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
R

Primary citation

PH domain-mediated autoinhibition and oncogenic activation of Akt. Bae, H., Viennet, T., Park, E. et al. Elife (2022) 11. DOI 10.7554/eLife.80148 · PubMed

Other PDB entries of the same protein (UniProt P31749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UNQ 0.98 Å, High resolution crystal structure of the Pleckstrin Homology Domain Of Protein Kinase…
1UNR 1.25 Å, Crystal structure of the PH domain of PKB alpha in complex with a sulfate molecule
1H10 1.4 Å, High resolution structure of the pleckstrin homology domain of protein kinase b/akt…
8JOW 1.4 Å, Crystal structure of rabbit antibody with phosphorylated peptide bound
4GV1 1.49 Å, PKB alpha in complex with AZD5363
1UNP 1.65 Å, Crystal structure of the pleckstrin homology domain of PKB alpha
3QKL 1.9 Å, Spirochromane Akt Inhibitors
7NH5 1.9 Å, Co-Crystal Structure of Akt1 in Complex with Covalent-Allosteric Akt Inhibitor 6
8UW9 1.9 Å, Structure of AKT1(E17K) with compound 4
9TMV 1.9 Å, Akt1 mutant in complex with the 3-ethyl 1-methyl 1,4-substituted pyrazole containing…
2UVM 1.94 Å, Structure of PKBalpha PH domain in complex with a novel inositol headgroup surrogate,…
2UZR 1.94 Å, A transforming mutation in the pleckstrin homology domain of AKT1 in cancer (AKT1-PH_E17K)

Browse structure collections

About this viewer

MolViewer shows 7MYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.