7MZY: ALK tyrosine kinase receptor

Anaplastic lymphoma kinase (ALK) extracellular fragment of ligand binding region 673-986. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Nov 2021.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,868
Mol. weight: 64.7 kDa
Released: 24 Nov 2021

Explore 7MZY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MZY contains 41 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	680-685	6	1
α-helix	698-704	7
β-strand	713-714	2	2
β-strand	715	1	3
α-helix	718-720	3
β-strand	721	1	3
β-strand	724-727	4	2
β-strand	732-739	8	1
α-helix	740-745	6
α-helix	752-756	5
β-strand	757-765	9	1
β-strand	770-774	5	2
α-helix	778-781	4
α-helix	788-794	7
α-helix	800-807	8
α-helix	818-824	7
β-strand	825-831	7	2
β-strand	834-841	8	2
α-helix	842-848	7
α-helix	857-859	3
β-strand	861-862	2	2
α-helix	871-873	3
α-helix	878-881	4
α-helix	893-895	3
α-helix	896-898	3
α-helix	901-903	3
α-helix	907-913	7
α-helix	918-920	3
α-helix	924-927	4
α-helix	931-935	5
β-strand	938	1	4
α-helix	939-943	5
α-helix	951-955	5
β-strand	956	1	4
β-strand	957-959	3	2
β-strand	964-965	2	1
β-strand	970-971	2	1
β-strand	978-984	7	1

Chain B: 20 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	682-685	4	5
α-helix	698-704	7
β-strand	713-714	2	6
β-strand	715	1	7
α-helix	718-720	3
β-strand	721	1	7
β-strand	724-727	4	6
β-strand	732-739	8	5
α-helix	740-745	6
α-helix	752-755	4
β-strand	756-765	10	5
β-strand	770-774	5	6
α-helix	778-781	4
α-helix	788-795	8
α-helix	800-808	9
α-helix	818-824	7
β-strand	825-831	7	6
β-strand	834-841	8	6
α-helix	842-848	7
β-strand	861-862	2	6
α-helix	870-873	4
α-helix	878-881	4
α-helix	893-895	3
α-helix	896-898	3
α-helix	901-906	6
α-helix	907-913	7
α-helix	918-920	3
α-helix	924-927	4
α-helix	931-935	5
β-strand	938	1	8
α-helix	939-943	5
α-helix	951-955	5
β-strand	956	1	8
β-strand	957-959	3	6
β-strand	964-965	2	5
β-strand	970-973	4	5
β-strand	978-983	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ALK tyrosine kinase receptor	A, B	protein	315	Homo sapiens	Q9UM73 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7MZY_1 ALK tyrosine kinase receptor (chains A, B)
GQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQIWKVPAT
DTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQ
KVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGA
KTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMK
KWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALK
VMEGHGEVNIKHYLN

Primary citation

Mechanism for the activation of the anaplastic lymphoma kinase receptor. Reshetnyak, A.V., Rossi, P., Myasnikov, A.G. et al. Nature (2021) 600:153-157. DOI 10.1038/s41586-021-04140-8 · PubMed

Other PDB entries of the same protein (UniProt Q9UM73 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Z55 1.55 Å, Anaplastic lymphoma kinase catalytic domain complexed with pyrazolopyrimidine derivative…
9GBE 1.58 Å, Structure of Human Anaplastic Lymphoma Kinase (ALK) harboring the G1202R/L1196M Compound…
5A9U 1.6 Å, Structure of C1156Y Mutant Human Anaplastic Lymphoma Kinase in Complex with PF-06463922…
8ARJ 1.65 Å, Anaplastic Lymphoma Kinase with a novel carboline inhibitor
4CLJ 1.66 Å, Structure of L1196M Mutant Human Anaplastic Lymphoma Kinase in Complex with PF-06463922…
2YFX 1.7 Å, Structure of L1196M Mutant Anaplastic Lymphoma Kinase in Complex with Crizotinib
4ANL 1.7 Å, Structure of G1269A Mutant Anaplastic Lymphoma Kinase
4FNX 1.7 Å, Crystal structure of the apo R1275Q anaplastic lymphoma kinase catalytic domain
4FOC 1.7 Å, Crystal structure of human anaplastic lymphoma kinase in complex with…
5AAC 1.7 Å, Structure of C1156Y Mutant Human Anaplastic Lymphoma Kinase in Complex with Crizotinib
5FTQ 1.7 Å, Crystal structure of the ALK kinase domain in complex with Cmpd 17
4CMT 1.73 Å, Structure of the Human Anaplastic Lymphoma Kinase in Complex with the inhibitor…

Browse structure collections

About this viewer

MolViewer shows 7MZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.