7N1O: PDB entry 7N1O

The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone. Determined by X-ray diffraction at 2.77 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 2.77 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,932
Mol. weight: 28.74 kDa
Ligands: MG
Released: 9 Jun 2021

Explore 7N1O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7N1O contains 15 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	18-31	14
α-helix	34-38	5
α-helix	46-49	4
α-helix	54-60	7
α-helix	65-79	15
β-strand	83-90	8	1
α-helix	93-98	6
α-helix	99-110	12
β-strand	118-125	8	1
β-strand	129-136	8	1
α-helix	139-150	12
α-helix	160-174	15
β-strand	180-187	8	1
α-helix	195-208	14
β-strand	212-217	6	1
α-helix	223-229	7
α-helix	233-235	3
β-strand	236-238	3	1
α-helix	239-241	3
α-helix	242-254	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,Isoform 4 of Anthrax toxin receptor 2	A	protein	257	Homo sapiens	P41212 (AlphaFold model), P58335 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7N1O_1 Transcription factor ETV6,Isoform 4 of Anthrax toxin receptor 2 (chains A)
GSIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYR
SPHSGDELYELLQHILAQARAAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRL
SFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTS
SIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVK
GGFQALKGIINSILAQS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystals of TELSAM-target protein fusions that exhibit minimal crystal contacts and lack direct inter-TELSAM contacts. Nawarathnage, S., Soleimani, S., Mathis, M.H. et al. Open Biol (2022) 12:210271-210271. DOI 10.1098/rsob.210271 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 7N1O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.