7N40: LIN9-RbAp48-LIN37, a MuvB subcomplex

Crystal structure of LIN9-RbAp48-LIN37, a MuvB subcomplex. Determined by X-ray diffraction at 2.55 Å resolution. Released 9 Feb 2022.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,860
Mol. weight: 73.2 kDa
Released: 9 Feb 2022

Explore 7N40 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7N40 contains 16 α-helices and 40 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	11-31	21
β-strand	32-39	8	1
β-strand	47-54	8	2
β-strand	61-69	9	2
β-strand	77-87	11	2
β-strand	93	1	3
β-strand	99	1	1
β-strand	106-108	3	1
β-strand	116-123	8	2
β-strand	129-133	5	4
β-strand	136-143	8	4
β-strand	149-153	5	4
α-helix	154-156	3
α-helix	161-162	2
β-strand	171-173	3	4
β-strand	180-185	6	5
β-strand	192-197	6	5
β-strand	202-206	5	5
β-strand	216-217	2	4
β-strand	221-223	3	5
β-strand	230-235	6	6
β-strand	242-247	6	6
β-strand	251-256	6	6
β-strand	267-270	4	6
β-strand	276-281	6	7
β-strand	288-293	6	7
β-strand	298-302	5	7
β-strand	311-313	3	7
β-strand	320-325	6	8
β-strand	332-337	6	8
β-strand	342-346	5	8
α-helix	347-349	3
α-helix	356-359	4
β-strand	366-370	5	8
β-strand	377-382	6	1
β-strand	389-394	6	1
β-strand	398-404	7	1

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	99-113	15
α-helix	116-126	11
α-helix	132-137	6
α-helix	141-149	9
β-strand	158	1	3
α-helix	160-170	11
α-helix	172-175	4
α-helix	178-197	20
α-helix	217-219	3
β-strand	225-229	5	9
β-strand	237-246	10	9
β-strand	251-256	6	9
β-strand	263-267	5	9
α-helix	268-270	3
β-strand	271-273	3	9

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	96-99	4	10
β-strand	102-105	4	10
α-helix	106-108	3
α-helix	115-123	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-binding protein RBBP4	A	protein	425	Homo sapiens	Q09028 (AlphaFold model)
Isoform 2 of Protein lin-9 homolog	B	protein	180	Homo sapiens	Q5TKA1 (AlphaFold model)
Protein lin-37 homolog	C	protein	39	Homo sapiens	Q96GY3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7N40_1 Histone-binding protein RBBP4 (chains A)
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS

Sequence of entity 2 (B), FASTA

>7N40_2 Isoform 2 of Protein lin-9 homolog (chains B)
STPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLK
TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPD
EIPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSN

Sequence of entity 3 (C), FASTA

>7N40_3 Protein lin-37 homolog (chains C)
SNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPSVR

Primary citation

The MuvB complex binds and stabilizes nucleosomes downstream of the transcription start site of cell-cycle dependent genes. Asthana, A., Ramanan, P., Hirschi, A. et al. Nat Commun (2022) 13:526-526. DOI 10.1038/s41467-022-28094-1 · PubMed

Other PDB entries of the same protein (UniProt Q09028 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R7A 1.85 Å, Crystal Structure of RBBP4 bound to PHF6 peptide
7M40 1.88 Å, Discovery of small molecule antagonists of human Retinoblastoma Binding Protein 4 (RBBP4)
2XU7 1.9 Å, Structural basis for RbAp48 binding to FOG-1
5XXQ 1.9 Å, Crystal structure of RBBP4: ZNF827 and its function in telomere
6BW4 2.0 Å, Crystal structure of RBBP4 in complex with PRDM16 N-terminal peptide
9V5M 2.1 Å, The crystal structure of RBBP4-H3 complex
5Y1U 2.14 Å, Crystal structure of RBBP4 bound to AEBP2 RRK motif
4PBZ 2.15 Å, Structure of the human RbAp48-MTA1(670-695) complex
6BW3 2.2 Å, Crystal structure of RBBP4 in complex with PRDM3 N-terminal peptide
8TX8 2.2 Å, Crystal Structure of RBBP4 bound to ZNF512B peptide
3GFC 2.3 Å, Crystal Structure of Histone-binding protein RBBP4
5VTB 2.4 Å, Crystal structure of RBBP4 bound to BCL11a peptide

Browse structure collections

About this viewer

MolViewer shows 7N40 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.