Crystal structure of the substrate-binding domain of E. coli DnaK in complex with the peptide RQKPLLGLSR. Determined by X-ray diffraction at 1.82 Å resolution. Released 23 Jun 2021.
Explore 7N6M in 3D Show helices and sheets RCSB PDB PDBe
7N6M contains 10 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 394 | 1 | 1 |
| β-strand | 399-403 | 5 | 2 |
| β-strand | 407-412 | 6 | 2 |
| α-helix | 416 | 1 | |
| β-strand | 417 | 1 | 1 |
| β-strand | 420-426 | 7 | 3 |
| β-strand | 427-428 | 2 | 4 |
| β-strand | 436-442 | 7 | 2 |
| β-strand | 447 | 1 | 2 |
| α-helix | 448-450 | 3 | |
| β-strand | 452-459 | 8 | 2 |
| α-helix | 462-463 | 2 | |
| β-strand | 472-478 | 7 | 3 |
| α-helix | 483 | 1 | |
| β-strand | 484-490 | 7 | 3 |
| β-strand | 496-501 | 6 | 3 |
| α-helix | 509-521 | 13 | |
| α-helix | 523-553 | 31 | |
| α-helix | 554-556 | 3 | |
| α-helix | 559-577 | 19 | |
| α-helix | 581-594 | 14 | |
| α-helix | 596-602 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 256-257 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chaperone protein DnaK | A | protein | 219 | Escherichia coli (strain K12) | P0A6Y8 (AlphaFold model) |
| Alkaline phosphatase peptide | B | protein | 10 | Escherichia coli (strain K12) | P00634 (AlphaFold model) |
>7N6M_1 Chaperone protein DnaK (chains A) VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRA ADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLN EDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESA LTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHA
>7N6M_2 Alkaline phosphatase peptide (chains B) RQKPLLGLSR
Selective promiscuity in the binding of E. coli Hsp70 to an unfolded protein. Clerico, E.M., Pozhidaeva, A.K., Jansen, R.M. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2016962118 · PubMed
Other PDB entries of the same protein (UniProt P0A6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7N6M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.