7NAM: LRP6_E1

LRP6_E1 in complex with Lr-EET-3.5. Determined by X-ray diffraction at 1.6 Å resolution. Released 29 Jun 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,072
Mol. weight: 40.79 kDa
Released: 29 Jun 2022

Explore 7NAM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NAM contains 7 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	22-26	5	1
β-strand	28-35	8	1
α-helix	42-43	2
β-strand	44-59	16	1
α-helix	60-62	3
β-strand	64-69	6	1
β-strand	74-79	6	1
β-strand	88-92	5	1
β-strand	99-103	5	2
β-strand	108-113	6	2
β-strand	118-123	6	2
β-strand	130-133	4	2
β-strand	140-146	7	3
β-strand	151-156	6	3
β-strand	162-167	6	3
β-strand	174-177	4	3
β-strand	184-190	7	4
β-strand	195-200	6	4
β-strand	205-209	5	4
β-strand	217-220	4	4
β-strand	227-233	7	5
β-strand	236-241	6	5
β-strand	246-251	6	5
β-strand	259-262	4	5
β-strand	271-274	4	1
α-helix	276-278	3
α-helix	290-292	3
β-strand	296-299	4	6
β-strand	306-309	4	6
α-helix	314-315	2
β-strand	316	1	7
α-helix	317	1
β-strand	323	1	7

Chain B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	8
α-helix	16-18	3
β-strand	25	1	9
β-strand	30	1	8
β-strand	31	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low-density lipoprotein receptor-related protein 6	A	protein	317	Homo sapiens	O75581 (AlphaFold model)
Trypsin inhibitor 2	B	protein	32	synthetic construct

Sequence of entity 1 (A), FASTA

>7NAM_1 Low-density lipoprotein receptor-related protein 6 (chains A)
GSAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKR
TEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQEL
DQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLY
WADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEG
LREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLL
ENGKTCKDGNSHHHHHH

Sequence of entity 2 (B), FASTA

>7NAM_2 Trypsin inhibitor 2 (chains B)
GCQSNHILKHNRCKQDSDCLAGCVCGPNGFCG

Primary citation

Directed evolution identifies high-affinity cystine-knot peptide agonists and antagonists of Wnt/ beta-catenin signaling. Hansen, S., Zhang, Y., Hwang, S. et al. Proc Natl Acad Sci U S A (2022) 119:e2207327119-e2207327119. DOI 10.1073/pnas.2207327119 · PubMed

Other PDB entries of the same protein (UniProt O75581 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SOV 1.27 Å, The structure of a beta propeller domain in complex with peptide S
8FFE 1.72 Å, Crystal structure of LRP6 E1E2 domains bound to YW210.09 Fab and engineered XWnt8 peptide
3SOB 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a FAB
3SOQ 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a DKK1…
4A0P 1.9 Å, Crystal structure of LRP6P3E3P4E4
8DVM 2.0 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.6
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8DVL 2.5 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.18
5AIR 2.53 Å, Structural analysis of mouse GSK3beta fused with LRP6 peptide.
8DVN 2.53 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.10
6H15 2.6 Å, Structure of LRP6 P3E3P4E4 in complex with VHH L-P2-B10

Browse structure collections

About this viewer

MolViewer shows 7NAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.