7NW1: UFC1

Crystal structure of UFC1 in complex with UBA5. Determined by X-ray diffraction at 1.95 Å resolution. Released 29 Sept 2021.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,051
Mol. weight: 44.19 kDa
Released: 29 Sept 2021

Explore 7NW1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NW1 contains 23 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	14-16	3
α-helix	25-48	24
β-strand	54-58	5	1
β-strand	64-73	10	1
β-strand	76-85	10	1
α-helix	86-87	2
α-helix	94-95	2
β-strand	98	1	1
α-helix	100-102	3
β-strand	109-110	2	1
β-strand	114-115	2	1
α-helix	116-118	3
α-helix	121-126	6
α-helix	134-137	4
α-helix	138-142	5
α-helix	143-155	13
β-strand	163	1	1

Chain BBB: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	14-16	3
α-helix	25-48	24
β-strand	54-58	5	2
β-strand	64-73	10	2
β-strand	76-85	10	2
α-helix	86-87	2
α-helix	94-95	2
β-strand	98	1	2
α-helix	100-102	3
β-strand	109-110	2	2
β-strand	114-115	2	2
α-helix	121-126	6
α-helix	134-137	4
α-helix	138-142	5
α-helix	143-155	13
β-strand	163	1	2

Chains CCC and FFF: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	173-181	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-fold modifier-conjugating enzyme 1	AAA, BBB	protein	168	Homo sapiens	Q9Y3C8 (AlphaFold model)
Ubiquitin-like modifier-activating enzyme 5	CCC, FFF	protein	16	Homo sapiens	Q9GZZ9 (AlphaFold model)

Sequence of entity 1 (AAA, BBB), FASTA

>7NW1_1 Ubiquitin-fold modifier-conjugating enzyme 1 (chains AAA, BBB)
GMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESN
KEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTD
HFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ

Sequence of entity 2 (CCC, FFF), FASTA

>7NW1_2 Ubiquitin-like modifier-activating enzyme 5 (chains CCC, FFF)
DSGESLEDLMAKMKNM

Primary citation

Structural basis for UFM1 transfer from UBA5 to UFC1. Kumar, M., Padala, P., Fahoum, J. et al. Nat Commun (2021) 12:5708-5708. DOI 10.1038/s41467-021-25994-6 · PubMed

Other PDB entries of the same protein (UniProt Q9Y3C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GLH 1.11 Å, Crystal Structure of UFC1 T106S
9GLJ 1.21 Å, Crystal Structure of UFC1 T106A
9GMM 1.35 Å, Crystal Structure of UFC1 T106I
9GLI 1.43 Å, Crystal Structure of UFC1 T106C
9GLO 1.53 Å, Crystal Structure of UFC1 C116E&T106S
9I9M 1.54 Å, Crystal structure of chimeric UFC1, TAK MotiF replaced with HPN motif of other E2 proteins
2Z6O 1.6 Å, Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1
9GLL 1.65 Å, Crystal Structure of UFC1 T106L
9GLP 1.77 Å, Crystal Structure of UFC1 C116E&T106I
8BZR 1.78 Å, UFC1-UFM1 conjugate
9GLM 1.79 Å, Crystal Structure of UFC1 W145F
2Z6P 1.8 Å, Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1

Browse structure collections

About this viewer

MolViewer shows 7NW1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.