7OAA: PDB entry 7OAA

conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors. Determined by X-ray diffraction at 1.4 Å resolution. Released 4 May 2022.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Candidatus Magnetomorum sp. HK-1
Chains: 1
Atoms: 803
Mol. weight: 10.14 kDa
Released: 4 May 2022

Explore 7OAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OAA contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	283-312	30
α-helix	315-316	2
α-helix	317-319	3
α-helix	323-325	3
α-helix	329-360	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from…	A	protein	86	Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Candidatus Magnetomorum sp. HK-1	P03069 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7OAA_1 General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors,General control transcription factor GCN4 (chains A)
GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADVYTKDQLYTKTEINSQMK
QIEWKIEEILSKIYHIENEIARIKKL

Primary citation

conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors. Adlakha, J. To be published.

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 7OAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.