Nanobody H3 AND C1 bound to RBD with Kent mutation. Determined by X-ray diffraction at 1.55 Å resolution. Released 11 Aug 2021.
Explore 7OAQ in 3D Show helices and sheets RCSB PDB PDBe
7OAQ contains 20 α-helices and 41 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 33-39 | 7 | 2 |
| β-strand | 46-52 | 7 | 2 |
| β-strand | 57-60 | 4 | 2 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 1 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 2 |
| β-strand | 102-105 | 4 | 3 |
| α-helix | 108-110 | 3 | |
| β-strand | 113-114 | 2 | 2 |
| α-helix | 115-117 | 3 | |
| β-strand | 118-122 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 335 | 1 | 4 |
| α-helix | 339-342 | 4 | |
| β-strand | 349 | 1 | 3 |
| α-helix | 350-352 | 3 | |
| β-strand | 354-358 | 5 | 3 |
| β-strand | 361-362 | 2 | 4 |
| α-helix | 365-369 | 5 | |
| β-strand | 376-380 | 5 | 3 |
| α-helix | 384-387 | 4 | |
| β-strand | 391-392 | 2 | 4 |
| β-strand | 394-403 | 10 | 3 |
| α-helix | 404-409 | 6 | |
| α-helix | 417-421 | 5 | |
| β-strand | 431-437 | 7 | 3 |
| α-helix | 439-442 | 4 | |
| β-strand | 448 | 1 | 5 |
| β-strand | 452-454 | 3 | 6 |
| α-helix | 460-462 | 3 | |
| α-helix | 471-472 | 2 | |
| β-strand | 473-474 | 2 | 7 |
| β-strand | 483 | 1 | 8 |
| β-strand | 485 | 1 | 7 |
| β-strand | 488-489 | 2 | 7 |
| β-strand | 492-494 | 3 | 6 |
| β-strand | 497 | 1 | 5 |
| α-helix | 503-505 | 3 | |
| β-strand | 507-516 | 10 | 3 |
| β-strand | 524-525 | 2 | 4 |
| α-helix | 527-529 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-8 | 4 | 9 |
| β-strand | 10-13 | 4 | 8 |
| β-strand | 18-23 | 6 | 9 |
| α-helix | 28-31 | 4 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 46-51 | 6 | 8 |
| β-strand | 58-60 | 3 | 8 |
| β-strand | 68-72 | 5 | 9 |
| β-strand | 78-83 | 6 | 9 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 8 |
| α-helix | 106-108 | 3 | |
| α-helix | 111-113 | 3 | |
| β-strand | 115 | 1 | 8 |
| α-helix | 117-120 | 4 | |
| β-strand | 121-126 | 6 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| H3 | AAA | protein | 131 | Lama glama | |
| Spike protein S1 | EEE | protein | 210 | Severe acute respiratory syndrome coronavirus 2 | P0DTC2 (AlphaFold model) |
| H3 | FFF | protein | 136 | Lama glama |
>7OAQ_1 H3 (chains AAA) QVQLVESGGGLVQPGGSLRLSCAASGFTNDFYSIAWFRQAPGKEREGVSWLSVSDNTPTY VDSVKDRFTISRHNANNTVYLQMNMLKPEDTAIYYCAAGRFAGRDTWPSSYDYWGQGTQV TVSSKHHHHHH
>7OAQ_2 Spike protein S1 (chains EEE) PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLND LCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNY NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYR VVVLSFELLHAPATVCGPKKSTNKHHHHHH
>7OAQ_3 H3 (chains FFF) MAQVQLVESGGGLVKTGGSLRLSCAASGRTFSTYSMGWFRQAPGKEREFVAGMRWTGSST FYSDSVKGRFTVSRNNAKDTVYLHMNSLKPEDTAVYYCAITTIVRAYYTEYTEADFGSWG QGTQVTVSSKHHHHHH
Water and common crystallization additives (CL) are not listed.
A potent SARS-CoV-2 neutralising nanobody shows therapeutic efficacy in the Syrian golden hamster model of COVID-19. Huo, J., Mikolajek, H., Le Bas, A. et al. Nat Commun (2021) 12:5469-5469. DOI 10.1038/s41467-021-25480-z · PubMed
Other PDB entries of the same protein (UniProt P0DTC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7OAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.