7OCE: Resting state GluA1/A2 AMPA receptor
Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and CNIH2 (LBD-TMD). Determined by electron microscopy at 3.1 Å resolution. Released 9 Jun 2021.
- Method
- Electron microscopy
- Resolution
- 3.1 Å
- Organism
- Rattus norvegicus
- Chains
- 8
- Atoms
- 18,092
- Mol. weight
- 567.32 kDa
- Ligands
- E2Q, PC1, CLR
- Released
- 9 Jun 2021
Explore 7OCE in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7OCE contains 106 α-helices and 90 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and C: 20 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 388-390 | 3 | |
| β-strand | 391-394 | 4 | 1 |
| β-strand | 398 | 1 | 2 |
| β-strand | 402 | 1 | 2 |
| β-strand | 403-404 | 2 | 3 |
| α-helix | 405 | 1 | |
| α-helix | 408-410 | 3 | |
| α-helix | 413-416 | 4 | |
| β-strand | 417-418 | 2 | 3 |
| α-helix | 420-432 | 13 | |
| β-strand | 436-438 | 3 | 1 |
| β-strand | 449 | 1 | 4 |
| β-strand | 456 | 1 | 4 |
| α-helix | 459-464 | 6 | |
| β-strand | 470-476 | 7 | 1 |
| α-helix | 479-484 | 6 | |
| β-strand | 485-486 | 2 | 5 |
| β-strand | 492-494 | 3 | 1 |
| β-strand | 496-501 | 6 | 6 |
| α-helix | 508-509 | 2 | |
| β-strand | 517 | 1 | 7 |
| α-helix | 519-540 | 22 | |
| α-helix | 569-580 | 12 | |
| α-helix | 592-625 | 34 | |
| α-helix | 632-637 | 6 | |
| β-strand | 642-644 | 3 | 6 |
| β-strand | 646 | 1 | 8 |
| α-helix | 650-656 | 7 | |
| α-helix | 661-669 | 9 | |
| β-strand | 679 | 1 | 8 |
| α-helix | 682-691 | 10 | |
| β-strand | 696-701 | 6 | 6 |
| α-helix | 702-709 | 8 | |
| β-strand | 716-719 | 4 | 6 |
| β-strand | 726-731 | 6 | 1 |
| β-strand | 732-733 | 2 | 5 |
| α-helix | 740-752 | 13 | |
| α-helix | 754-763 | 10 | |
| β-strand | 783 | 1 | 9 |
| α-helix | 784 | 1 | |
| α-helix | 789-819 | 31 | |
Chain B: 23 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 397-398 | 2 | 10 |
| β-strand | 407-408 | 2 | 11 |
| α-helix | 409 | 1 | |
| β-strand | 421-422 | 2 | 11 |
| α-helix | 424-436 | 13 | |
| β-strand | 452-453 | 2 | 12 |
| β-strand | 460-461 | 2 | 12 |
| α-helix | 462-468 | 7 | |
| β-strand | 474-475 | 2 | 10 |
| α-helix | 479 | 1 | |
| β-strand | 480 | 1 | 13 |
| α-helix | 481 | 1 | |
| α-helix | 483-486 | 4 | |
| β-strand | 489-491 | 3 | 10 |
| β-strand | 496-498 | 3 | 13 |
| β-strand | 500-505 | 6 | 14 |
| α-helix | 506-507 | 2 | |
| α-helix | 510-513 | 4 | |
| α-helix | 516-518 | 3 | |
| β-strand | 521 | 1 | 9 |
| α-helix | 523-546 | 24 | |
| α-helix | 573-584 | 12 | |
| α-helix | 596-625 | 30 | |
| α-helix | 637-641 | 5 | |
| β-strand | 646-648 | 3 | 14 |
| β-strand | 650 | 1 | 15 |
| α-helix | 654-660 | 7 | |
| α-helix | 665-675 | 11 | |
| β-strand | 683 | 1 | 15 |
| α-helix | 686-695 | 10 | |
| β-strand | 700-705 | 6 | 14 |
| α-helix | 706-712 | 7 | |
| β-strand | 720-723 | 4 | 14 |
| β-strand | 730-732 | 3 | 13 |
| β-strand | 735-737 | 3 | 10 |
| α-helix | 743-756 | 14 | |
| α-helix | 758-763 | 6 | |
| α-helix | 764-768 | 5 | |
| α-helix | 782-786 | 5 | |
| β-strand | 787 | 1 | 16 |
| α-helix | 789-791 | 3 | |
| α-helix | 793-821 | 29 | |
Chain D: 23 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 398 | 1 | 18 |
| β-strand | 407-408 | 2 | 19 |
| α-helix | 409 | 1 | |
| β-strand | 421-422 | 2 | 19 |
| α-helix | 424-436 | 13 | |
| β-strand | 452-453 | 2 | 20 |
| β-strand | 460-461 | 2 | 20 |
| α-helix | 462-468 | 7 | |
| β-strand | 475 | 1 | 18 |
| α-helix | 479 | 1 | |
| β-strand | 480 | 1 | 21 |
| α-helix | 481 | 1 | |
| α-helix | 483-486 | 4 | |
| β-strand | 489-491 | 3 | 18 |
| β-strand | 496-498 | 3 | 21 |
| β-strand | 500-505 | 6 | 22 |
| α-helix | 506-507 | 2 | |
| α-helix | 510-513 | 4 | |
| α-helix | 516-518 | 3 | |
| β-strand | 521 | 1 | 23 |
| α-helix | 523-546 | 24 | |
| α-helix | 573-584 | 12 | |
| α-helix | 596-625 | 30 | |
| α-helix | 637-641 | 5 | |
| β-strand | 646-648 | 3 | 22 |
| β-strand | 650 | 1 | 24 |
| α-helix | 654-660 | 7 | |
| α-helix | 665-675 | 11 | |
| β-strand | 683 | 1 | 24 |
| α-helix | 686-695 | 10 | |
| β-strand | 700-705 | 6 | 22 |
| α-helix | 706-712 | 7 | |
| β-strand | 720-723 | 4 | 22 |
| β-strand | 730-732 | 3 | 21 |
| β-strand | 735-737 | 3 | 18 |
| α-helix | 743-756 | 14 | |
| α-helix | 758-763 | 6 | |
| α-helix | 764-768 | 5 | |
| α-helix | 782-786 | 5 | |
| β-strand | 787 | 1 | 7 |
| α-helix | 789-791 | 3 | |
| α-helix | 793-821 | 29 | |
Chains E and G: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-39 | 35 | |
| α-helix | 47-66 | 20 | |
| α-helix | 68-84 | 17 | |
| α-helix | 88-107 | 20 | |
| α-helix | 125-158 | 34 | |
Chains I and J: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-40 | 24 | |
| β-strand | 45-49 | 5 | 17 |
| β-strand | 80-84 | 5 | 17 |
| β-strand | 88-91 | 4 | 17 |
| β-strand | 100-102 | 3 | 17 |
| α-helix | 116-127 | 12 | |
| α-helix | 129-148 | 20 | |
| α-helix | 158-183 | 26 | |
| β-strand | 200-201 | 2 | 17 |
| α-helix | 203-239 | 37 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Glutamate receptor 1 | A, C | protein | 915 | Rattus norvegicus | P19490 (AlphaFold model) |
| Glutamate receptor 2 | B, D | protein | 860 | Rattus norvegicus | P19491 (AlphaFold model) |
| Protein cornichon homolog 2 | E, G | protein | 188 | Rattus norvegicus | Q5BJU5 (AlphaFold model) |
| Voltage-dependent calcium channel gamma-8 subunit | I, J | protein | 422 | Rattus norvegicus | Q8VHW5 (AlphaFold model) |
Sequence of entity 1 (A, C), FASTA
>7OCE_1 Glutamate receptor 1 (chains A, C)
MPYIFAFFCTGFLGAVVGADYKDDDDKNFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEP
PKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS
FPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQV
TAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILAN
LGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSAL
TYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGN
VQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVT
TILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTK
AWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKG
KYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGV
LDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKS
RSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIP
CMSHSSGMPLGATGL
Sequence of entity 2 (B, D), FASTA
>7OCE_2 Glutamate receptor 2 (chains B, D)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSS
Sequence of entity 3 (E, G), FASTA
>7OCE_3 Protein cornichon homolog 2 (chains E, G)
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI
CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV
SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSFENLYFQSGGSTETSQVAPAY
PYDVPDYA
Sequence of entity 4 (I, J), FASTA
>7OCE_4 Voltage-dependent calcium channel gamma-8 subunit (chains I, J)
ESLKRWNEERGLWCEKGVQVLLTTIGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAGD
DGPPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLL
RVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYIS
ANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSDL
LKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFAS
TDISMYTLSRDPSKGSVAAGLASAGGGGGGAGVGAYGGAAGAAGGGGTGSERDRGSSAGF
LTLHNAFPKEAASGVTVTVTGPPAAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKLEVL
FQ
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| E2Q | 6-nitro-2,3-bis(oxidanylidene)-1,4-dihydrobenzo[f]quinoxaline-7-sulfonamide | C12 H8 N4 O6 S | 4 |
| PC1 | 1,2-diacyl-sn-glycero-3-phosphocholine | C44 H88 N O8 P | 46 |
| CLR | Cholesterol | C27 H46 O | 2 |
Primary citation
Gating and modulation of a hetero-octameric AMPA glutamate receptor. Zhang, D., Watson, J.F., Matthews, P.M. et al. Nature (2021) 594:454-458. DOI 10.1038/s41586-021-03613-0 · PubMed
Other PDB entries of the same protein (UniProt P19490 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
- 3SAJ 2.5 Å, Crystal Structure of glutamate receptor GluA1 Amino Terminal Domain
- 8C2H 2.64 Å, Transmembrane domain of active state homomeric GluA1 AMPA receptor in tandem with TARP…
- 8C2I 2.7 Å, Transmembrane domain of resting state homomeric GluA1 AMPA receptor in complex with TARP…
- 8AYN 2.8 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand LY3130481
- 8C1Q 2.82 Å, Resting state homomeric GluA1 AMPA receptor in complex with TARP gamma 3
- 8C1P 2.9 Å, Active state homomeric GluA1 AMPA receptor in complex with TARP gamma 3
- 8AYL 3.2 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-61432059
- 9OVU 3.2 Å, Composite map of GluA1/A2 in the activated state, in complex with positive allosteric…
- 9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD
- 8AYM 3.3 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-55511118
- 8AYO 3.3 Å, Open state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-61432059
Browse structure collections
About this viewer
MolViewer shows 7OCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.