7OI5: AP2 Mu2 - FCHO2 chimera

Name: PDB 7OI5: Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
Published: 2022-06-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved). Determined by X-ray diffraction at 2.61 Å resolution. Released 1 Jun 2022.

Method: X-ray diffraction
Resolution: 2.61 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 4,669
Mol. weight: 79.03 kDa
Released: 1 Jun 2022

Explore 7OI5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OI5 contains 10 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	167	1	1
β-strand	172-185	14	2
β-strand	191-205	15	2
β-strand	211-216	6	3
α-helix	221-223	3
β-strand	245-248	4	2
β-strand	252	1	3
α-helix	254-260	7
β-strand	263-265	3	3
α-helix	267-268	2
β-strand	270-279	10	2
β-strand	287-296	10	4
β-strand	300-309	10	4
β-strand	316-325	10	2
β-strand	330-337	8	4
β-strand	341-345	5	2
β-strand	350-359	10	2
β-strand	365-372	8	4
α-helix	384-385	2
β-strand	386-392	7	2
β-strand	401-408	8	3
β-strand	413-414	2	3
α-helix	415-417	3
β-strand	419-433	15	2
β-strand	483	1	1

Chain D: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	167	1	5
β-strand	172-185	14	6
β-strand	191-205	15	6
β-strand	212-215	4	7
β-strand	245-248	4	6
β-strand	252	1	7
α-helix	254-259	6
β-strand	263-265	3	7
α-helix	267-268	2
β-strand	270-279	10	6
β-strand	287-296	10	8
β-strand	300-309	10	8
β-strand	316-325	10	6
β-strand	330-337	8	8
β-strand	341-345	5	6
β-strand	350-359	10	6
β-strand	363-372	10	8
α-helix	384-385	2
β-strand	386-392	7	6
β-strand	403-405	3	7
β-strand	407-408	2	9
β-strand	413-414	2	9
α-helix	415-417	3
β-strand	419-433	15	6
β-strand	483	1	5
α-helix	486-488	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit mu,F-BAR domain only protein 2	B, D	protein	359	Rattus norvegicus, Homo sapiens	P84092 (AlphaFold model), Q0JRZ9 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>7OI5_1 AP-2 complex subunit mu,F-BAR domain only protein 2 (chains B, D)
PGIHMQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPEC
KFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEF
ELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSG
VQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEV
PFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRCGASGSAGSAGPSGAGSA
GSAGPSAGSAGSAGSGSAGSAPGPDVDEEGYSIKPETNQNDTKENHFYSSSDSDSEDEE

Primary citation

FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P 2 -dependent switch. Zaccai, N.R., Kadlecova, Z., Dickson, V.K. et al. Sci Adv (2022) 8:eabn2018-eabn2018. DOI 10.1126/sciadv.abn2018 · PubMed

Other PDB entries of the same protein (UniProt P84092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OIQ 1.85 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
7OFP 1.92 Å, Apo Structure of Mu2 Adaptin Subunit (Ap50) Of AP2 Clathrin Adaptor
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
1I31 2.5 Å, MU2 adaptin subunit (AP50) of AP2 clathrin adaptor, complexed with EGFR internalization…
2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
6QH5 2.56 Å, AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation
5WRM 2.6 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y658 peptide
2VGL 2.6 Å, AP2 clathrin adaptor core
3H85 2.6 Å, Molecular basis for the association of PIPKI gamma-p90 with the clathrin adaptor AP-2
5WRK 2.62 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y608 peptide
1BW8 2.65 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with EGFR…
1BXX 2.7 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with TGN38…

Browse structure collections

About this viewer

MolViewer shows 7OI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.