7OOB: Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3

Name: PDB 7OOB: Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
Published: 2021-10-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2). Determined by electron microscopy at 2.7 Å resolution. Released 13 Oct 2021.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Sus scrofa, Homo sapiens
Chains: 18
Atoms: 46,261
Mol. weight: 890.9 kDa
Ligands: ZN, MG, ADP, BEF
Released: 13 Oct 2021

Explore 7OOB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OOB contains 239 α-helices and 354 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 3 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	15-28	14
β-strand	30-32	3	97
β-strand	36-38	3	98
β-strand	46-51	6	99
β-strand	58-63	6	99
β-strand	68-72	5	99
β-strand	82-84	3	98
β-strand	86-90	5	99
β-strand	102-107	6	100
α-helix	108	1
β-strand	114-119	6	100
β-strand	123-128	6	100
β-strand	133-139	7	100
β-strand	144-149	6	101
β-strand	158-163	6	101
β-strand	168-172	5	101
β-strand	177	1	101
β-strand	181-182	2	101
β-strand	189-194	6	102
β-strand	201-206	6	102
β-strand	211-215	5	102
β-strand	224-225	2	102
β-strand	227	1	103
β-strand	248-253	6	104
β-strand	259-264	6	104
β-strand	268-273	6	104
β-strand	278	1	103
β-strand	279	1	104
β-strand	296	1	97
β-strand	298-299	2	105
β-strand	307-312	6	105
β-strand	315-320	6	105
β-strand	326-331	6	105
β-strand	337-343	7	97
β-strand	348-353	6	97
β-strand	358-363	6	97

Chain A: 81 helices, 71 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15-16	2	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	43	1	4
β-strand	47-48	2	5
β-strand	51-52	2	5
α-helix	53	1
β-strand	56	1	4
α-helix	60-62	3
β-strand	86-95	10	6
α-helix	100-109	10
β-strand	110	1	7
β-strand	117	1	7
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	8
β-strand	187	1	8
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	214-216	3	9
α-helix	218-226	9
α-helix	230-235	6
α-helix	246-248	3
β-strand	249-255	7	6
α-helix	256	1
β-strand	264-265	2	10
β-strand	271-272	2	10
α-helix	273-274	2
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-329	4
α-helix	331-333	3
α-helix	334-336	3
α-helix	339-342	4
α-helix	349	1
α-helix	350-354	5
β-strand	357-359	3	11
β-strand	362-369	8	12
β-strand	377-381	5	12
α-helix	382-387	6
β-strand	389-393	5	13
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	13
β-strand	426-428	3	13
α-helix	435-438	4
β-strand	445-449	5	13
α-helix	450	1
β-strand	455-459	5	12
α-helix	466-468	3
β-strand	469-477	9	12
β-strand	482-484	3	12
α-helix	489-492	4
β-strand	500-504	5	12
α-helix	509-514	6
α-helix	515-519	5
β-strand	520	1	12
α-helix	521-524	4
β-strand	526-527	2	14
β-strand	532-533	2	14
α-helix	539-548	10
β-strand	554-555	2	15
α-helix	557-564	8
α-helix	573-574	2
β-strand	575	1	16
α-helix	576-577	2
β-strand	579-581	3	17
β-strand	585	1	17
β-strand	586-587	2	15
α-helix	588-595	8
β-strand	602-603	2	18
β-strand	629-631	3	18
β-strand	634-637	4	18
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
β-strand	686	1	19
α-helix	689-692	4
α-helix	696-721	26
α-helix	727-728	2
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-781	4
α-helix	782-786	5
β-strand	789-790	2	20
β-strand	793	1	21
β-strand	796	1	21
α-helix	798-799	2
β-strand	822-823	2	20
α-helix	833-868	36
β-strand	872-873	2	22
β-strand	879-880	2	22
β-strand	886-888	3	22
α-helix	891-893	3
β-strand	896	1	23
β-strand	902-905	4	24
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	25
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	24
α-helix	983-993	11
α-helix	1001	1
β-strand	1002	1	25
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1053-1056	4
α-helix	1062-1079	18
β-strand	1080	1	23
α-helix	1081-1082	2
α-helix	1087-1096	10
α-helix	1098-1100	3
α-helix	1121-1128	8
β-strand	1139-1142	4	26
β-strand	1143	1	27
α-helix	1146-1149	4
α-helix	1151-1161	11
β-strand	1164-1165	2	28
α-helix	1166-1169	4
β-strand	1170-1177	8	29
α-helix	1190-1197	8
β-strand	1207-1216	10	29
α-helix	1218-1223	6
α-helix	1228-1238	11
α-helix	1240-1242	3
β-strand	1243-1247	5	29
β-strand	1256-1262	7	29
α-helix	1281-1295	15
β-strand	1297-1299	3	28
β-strand	1307-1310	4	26
β-strand	1319-1322	4	30
β-strand	1328-1331	4	30
β-strand	1335-1338	4	26
α-helix	1343-1347	5
β-strand	1352	1	27
β-strand	1358-1359	2	26
α-helix	1362-1368	7
α-helix	1371-1387	17
α-helix	1395-1404	10
β-strand	1408-1409	2	31
α-helix	1416-1419	4
α-helix	1426-1432	7
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1467-1469	3
β-strand	1471-1475	5	32

Chain b: 32 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	491-492	2	77
β-strand	498-499	2	77
α-helix	501-506	6
α-helix	509-524	16
β-strand	528-530	3	78
α-helix	532-533	2
α-helix	539-551	13
β-strand	569-573	5	78
α-helix	575-577	3
α-helix	578-588	11
β-strand	594-597	4	78
α-helix	607-617	11
β-strand	620-624	5	78
α-helix	625-630	6
α-helix	632-635	4
β-strand	645-646	2	78
α-helix	648-651	4
α-helix	657-662	6
β-strand	671-673	3	78
α-helix	682-692	11
α-helix	700-703	4
α-helix	704-708	5
α-helix	709-713	5
α-helix	721-738	18
α-helix	739-741	3
β-strand	742-743	2	78
α-helix	751-753	3
α-helix	756-758	3
β-strand	759-766	8	79
α-helix	770-780	11
α-helix	783-789	7
α-helix	795-807	13
α-helix	835-837	3
α-helix	839-853	15
β-strand	858-862	5	79
α-helix	865-877	13
β-strand	884-885	2	79
α-helix	891-893	3
α-helix	894-903	10
β-strand	909-913	5	79
α-helix	914-917	4
β-strand	928-931	4	79
α-helix	938-945	8
β-strand	957-964	8	79
α-helix	968-987	20
α-helix	992-994	3
α-helix	1388-1398	11

Chain B: 56 helices, 82 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	19-36	18
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	67-68	2	33
β-strand	83-84	2	33
β-strand	87-93	7	33
β-strand	97-99	3	34
β-strand	105-107	3	34
α-helix	108-109	2
α-helix	110-116	7
β-strand	121-133	13	33
β-strand	139-153	15	33
α-helix	168-173	6
β-strand	185-187	3	35
β-strand	190-193	4	35
α-helix	194-195	2
β-strand	196-200	5	36
β-strand	206-208	3	37
β-strand	215-223	9	37
β-strand	233-240	8	37
α-helix	254-255	2
β-strand	256-259	4	37
β-strand	267-268	2	37
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-324	11
α-helix	332-341	10
α-helix	342-346	5
α-helix	349-351	3
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	36
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-450	13
β-strand	453	1	38
β-strand	463	1	38
β-strand	468-469	2	35
α-helix	470-471	2
α-helix	475-482	8
β-strand	484-486	3	36
α-helix	503-505	3
β-strand	509	1	39
β-strand	523-525	3	36
β-strand	526	1	39
β-strand	531-532	2	40
α-helix	539-547	9
β-strand	551-552	2	41
α-helix	558-561	4
β-strand	565-569	5	41
β-strand	572-577	6	41
α-helix	580-592	13
β-strand	602-605	4	41
β-strand	612-615	4	41
β-strand	621-627	7	40
β-strand	628	1	42
β-strand	633	1	42
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	40
α-helix	667-670	4
β-strand	675-676	2	40
α-helix	679-682	4
β-strand	695-696	2	40
α-helix	700-703	4
α-helix	708-710	3
α-helix	714-716	3
β-strand	717	1	43
α-helix	719-728	10
β-strand	732	1	44
β-strand	734	1	45
β-strand	747-751	5	45
β-strand	755	1	46
β-strand	759-760	2	47
α-helix	764-767	4
β-strand	776-782	7	48
β-strand	783	1	19
β-strand	793-797	5	48
α-helix	798-802	5
β-strand	808-817	10	45
β-strand	822	1	49
β-strand	825	1	49
β-strand	827-829	3	50
β-strand	848	1	51
β-strand	853	1	52
β-strand	854	1	51
α-helix	855	1
β-strand	859-860	2	45
β-strand	865-867	3	52
β-strand	869-871	3	50
β-strand	890-891	2	50
α-helix	893	1
β-strand	894-895	2	52
α-helix	896-897	2
β-strand	902-911	10	45
β-strand	917-927	11	45
β-strand	934-937	4	48
β-strand	942-949	8	48
β-strand	956-957	2	53
α-helix	961-963	3
β-strand	965-967	3	48
α-helix	969-971	3
β-strand	977	1	43
α-helix	978-993	16
β-strand	997-998	2	47
α-helix	1008-1016	9
β-strand	1025-1026	2	48
β-strand	1028-1029	2	53
α-helix	1035	1
β-strand	1036	1	53
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	48
β-strand	1051	1	44
α-helix	1055-1057	3
β-strand	1060-1061	2	12
β-strand	1067	1	54
β-strand	1074	1	54
α-helix	1082-1083	2
β-strand	1084-1086	3	11
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1113-1119	7	1
β-strand	1125	1	1
β-strand	1127-1129	3	55
β-strand	1134-1136	3	55
β-strand	1137	1	56
β-strand	1142	1	56
β-strand	1146-1152	7	1
α-helix	1153-1163	11
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain C: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	57
β-strand	18-24	7	57
α-helix	28-40	13
β-strand	44-55	12	58
α-helix	61-69	9
β-strand	73	1	59
α-helix	78-81	4
β-strand	99-106	8	58
α-helix	112	1
β-strand	113-116	4	60
α-helix	117-119	3
β-strand	121-122	2	58
β-strand	129	1	59
α-helix	147-148	2
β-strand	149-153	5	60
β-strand	158-168	11	58
α-helix	174-176	3
β-strand	179-186	8	57
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	57
α-helix	241-269	29

Chain d: 11 helices, 68 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	80
β-strand	15-21	7	81
β-strand	30-35	6	81
β-strand	38-44	7	81
β-strand	49-56	8	81
β-strand	61-67	7	82
β-strand	76-81	6	82
β-strand	85-94	10	82
β-strand	97-107	11	82
β-strand	115	1	83
β-strand	121-124	4	84
β-strand	130-134	5	84
β-strand	136	1	83
β-strand	139-144	6	84
β-strand	155-158	4	84
β-strand	164-169	6	85
α-helix	170	1
β-strand	177-184	8	85
β-strand	187-196	10	85
β-strand	201-204	4	85
β-strand	210-211	2	85
β-strand	218-221	4	86
β-strand	229-232	4	86
β-strand	237-240	4	86
β-strand	245-248	4	86
α-helix	251-253	3
β-strand	258-263	6	87
β-strand	270-275	6	87
β-strand	279-288	10	87
β-strand	296-307	12	87
β-strand	313-318	6	88
β-strand	321-325	5	88
β-strand	331-336	6	88
β-strand	347-353	7	88
β-strand	361-364	4	89
α-helix	367-369	3
β-strand	375-379	5	89
β-strand	386-392	7	89
β-strand	710-716	7	89
β-strand	720-727	8	90
β-strand	732-741	10	90
β-strand	751	1	90
β-strand	762-765	4	90
β-strand	786-795	10	90
β-strand	801-806	6	90
α-helix	807-808	2
β-strand	811-819	9	91
β-strand	828-835	8	91
β-strand	846-847	2	92
β-strand	848-854	7	91
β-strand	857-862	6	91
β-strand	865-866	2	92
β-strand	872-876	5	93
β-strand	879-884	6	93
β-strand	887-893	7	93
β-strand	899-905	7	93
β-strand	911-917	7	94
β-strand	920-925	6	94
β-strand	930-936	7	94
β-strand	941-948	8	94
β-strand	954-959	6	95
β-strand	964-969	6	95
β-strand	973-979	7	95
α-helix	987-990	4
β-strand	991	1	94
β-strand	992-999	8	95
β-strand	1004-1009	6	80
β-strand	1025-1032	8	80
β-strand	1037-1042	6	80
α-helix	1045-1061	17
α-helix	1070-1074	5
β-strand	1076-1078	3	96
β-strand	1081-1083	3	96
β-strand	1086	1	95
β-strand	1088-1090	3	80
α-helix	1091-1095	5
α-helix	1096-1098	3
α-helix	1102-1108	7
α-helix	1126-1137	12

Chain D: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	61
β-strand	21	1	61
α-helix	29	1
β-strand	30-31	2	62
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	78-89	12
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-136	13

Chain E: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	4-24	21
β-strand	26	1	63
α-helix	30-33	4
α-helix	37-44	8
β-strand	47	1	64
β-strand	52	1	64
α-helix	55-58	4
β-strand	60-63	4	65
β-strand	64	1	63
β-strand	71-75	5	65
β-strand	81-82	2	66
α-helix	84-97	14
β-strand	101-106	6	65
β-strand	109-110	2	66
α-helix	112-120	9
β-strand	126-131	6	65
α-helix	132-135	4
α-helix	139-141	3
β-strand	147-150	4	31
α-helix	151-152	2
α-helix	153-163	11
α-helix	167-169	3
β-strand	172-173	2	31
α-helix	178-183	6
β-strand	190-197	8	31
β-strand	201-209	9	31

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1970	Sus scrofa	A0A8D1DPV6
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa	I3LGP4 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RPOL4c domain-containing protein	D	protein	142	Sus scrofa	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerase II subunit F	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A8W4F9W9
RNA_pol_L_2 domain-containing protein	K	protein	117	Sus scrofa	F1RKE4
RNA polymerase II subunit K	L	protein	58	Sus scrofa	A0A4X1TRS6

6 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>7OOB_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>7OOB_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>7OOB_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>7OOB_4 RPOL4c domain-containing protein (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>7OOB_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>7OOB_6 DNA-directed RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>7OOB_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>7OOB_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>7OOB_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>7OOB_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>7OOB_11 RNA_pol_L_2 domain-containing protein (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>7OOB_12 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
BEF	Beryllium trifluoride ion	Be F3	1

Primary citation

Structural basis of human transcription-DNA repair coupling. Kokic, G., Wagner, F.R., Chernev, A. et al. Nature (2021) 598:368-372. DOI 10.1038/s41586-021-03906-4 · PubMed

Other PDB entries of the same protein (UniProt A0A8D1DPV6), best resolution first:

9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
8QEP 2.5 Å, RNA polymerase II bound to Alu RNA right arm
8B3D 2.6 Å, Structure of the Pol II-TCR-ELOF1 complex.
8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…

Browse structure collections

About this viewer

MolViewer shows 7OOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.