7OOT: Interferon regulatory factor 4

X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an interferon-stimulated response element. Determined by X-ray diffraction at 2.25 Å resolution. Released 8 Jun 2022.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 2,755
Mol. weight: 44.97 kDa
Ligands: PO4
Released: 8 Jun 2022

Explore 7OOT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OOT contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
β-strand	41-42	2	1
β-strand	49-53	5	1
α-helix	64-67	4
α-helix	69-77	9
α-helix	87-88	2
α-helix	90-103	14
β-strand	107-109	3	1
α-helix	111-113	3
β-strand	115	1	1
β-strand	122-127	6	1
α-helix	128-129	2

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
β-strand	41-42	2	2
β-strand	49-53	5	2
α-helix	64-67	4
α-helix	69-77	9
α-helix	90-103	14
β-strand	107-109	3	2
β-strand	115	1	2
β-strand	122-127	6	2
α-helix	128-129	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon regulatory factor 4	A, B	protein	141	Homo sapiens	Q15306 (AlphaFold model)
DNA (5'-d(ptpcpapapcptpgpapapapcpcpgpapgpapapapgpc)-3')	C	DNA	20	Mus musculus
DNA (5'-d(papgpcptptptpcptpcpgpgptptptpcpapgptptpg)-3')	E	DNA	20	Mus musculus

Sequence of entity 1 (A, B), FASTA

>7OOT_1 Interferon regulatory factor 4 (chains A, B)
MGSHHHHHHSAALEVLFQGPGGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAG
KQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDI
SDPYKVYRIVPEGAKKGAKQL

Sequence of entity 2 (C), FASTA

>7OOT_2 DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP*AP*GP*AP*AP*AP*GP*C)-3') (chains C)
TCAACTGAAACCGAGAAAGC

Sequence of entity 3 (E), FASTA

>7OOT_3 DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP*TP*CP*AP*GP*TP*TP*G)-3') (chains E)
AGCTTTCTCGGTTTCAGTTG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to interferon-stimulated response element. Agnarelli, A., El Omari, K., Alt, A.O. et al. To be published.

Other PDB entries of the same protein (UniProt Q15306 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TD4 1.71 Å, IRF4 DNA-binding domain surface entropy mutant apo structure
9VEH 2.0 Å, The MIDN Catch-IRF4 (A8M) fusion protein
9TOY 2.1 Å, Investigating the binding mechanism of Interferon Regulatory Factor 4 to DNA in the…
9VE3 2.1 Å, The MIDN Catch-IRF4 (V2L) fusion protein
9VE7 2.15 Å, The MIDN Catch-IRF4 (A8V) fusion protein
7OGS 2.37 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7RH2 2.47 Å, IRF4 Transcription factor mutant -K59R
9CUG 2.49 Å, X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain
9VE4 2.55 Å, The MIDN Catch-IRF4 fusion protein
7O56 2.6 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
9VE6 2.8 Å, The MIDN Catch-IRF4 (F6Y) fusion protein
9VE8 2.85 Å, The MIDN Catch-IRF4 (A8L) fusion protein

Browse structure collections

About this viewer

MolViewer shows 7OOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.