9CUG: PDB entry 9CUG

X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain. Determined by X-ray diffraction at 2.49 Å resolution. Released 24 Jun 2026.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,480
Mol. weight: 65.83 kDa
Released: 24 Jun 2026

Explore 9CUG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CUG contains 28 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	138-153	16
α-helix	158-177	20
α-helix	184-185	2
α-helix	200-215	16
α-helix	219-229	11
α-helix	233-236	4
α-helix	237-241	5
α-helix	242-246	5
β-strand	252-258	7	1
β-strand	261-267	7	1
β-strand	274-277	4	2
β-strand	288-291	4	2
α-helix	292-296	5
α-helix	301-308	8
β-strand	315-319	5	2
β-strand	323-328	6	2
β-strand	334-337	4	1
β-strand	348-350	3	1
α-helix	351	1
β-strand	355-360	6	2
α-helix	361-374	14
α-helix	376-380	5
β-strand	383-387	5	1
β-strand	401-407	7	1
α-helix	408-416	9

Chain B: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	138-153	16
α-helix	158-177	20
α-helix	184-185	2
α-helix	200-215	16
α-helix	219-228	10
α-helix	233-236	4
α-helix	237-241	5
α-helix	242-246	5
β-strand	252-258	7	3
β-strand	261-267	7	3
β-strand	274-277	4	4
β-strand	288-291	4	4
α-helix	292-296	5
α-helix	301-309	9
β-strand	315-319	5	4
β-strand	323-328	6	4
β-strand	334-337	4	3
β-strand	349-350	2	3
α-helix	351	1
β-strand	355-360	6	4
α-helix	361-374	14
α-helix	378-380	3
β-strand	383-387	5	3
β-strand	401-407	7	3
α-helix	408-417	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,Interferon regulatory factor 4	A, B	protein	286	Homo sapiens	P0ABE7 (AlphaFold model), Q15306 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9CUG_1 Soluble cytochrome b562,Interferon regulatory factor 4 (chains A, B)
SADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMK
DFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLAEALAFSDCRLHI
CLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERG
VVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHH
GRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN

Primary citation

Pharmacological targeting of IRF4 as a therapeutic strategy for multiple myeloma. Agius, M.P., Song, C., Liu, Q. et al. Nat Chem Biol (2026). DOI 10.1038/s41589-026-02228-8 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 9CUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.