9TOY: Interferon regulatory factor 4

Investigating the binding mechanism of Interferon Regulatory Factor 4 to DNA in the context of Multiple Myeloma. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Mar 2026.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,501
Mol. weight: 81.71 kDa
Ligands: CA
Released: 11 Mar 2026

Explore 9TOY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TOY contains 23 α-helices and 19 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-33	10
β-strand	41-42	2	1
β-strand	49-53	5	1
α-helix	64-77	14
α-helix	87-88	2
α-helix	90-103	14
β-strand	107-109	3	1
β-strand	115	1	1
β-strand	122-127	6	1
α-helix	128-130	3

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-33	10
β-strand	41-42	2	2
β-strand	49-53	5	2
α-helix	64-67	4
α-helix	69-77	9
α-helix	87-88	2
α-helix	90-103	14
β-strand	107-109	3	2
β-strand	115	1	2
β-strand	122-127	6	2
α-helix	128-129	2

Chain D: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-33	10
β-strand	41-42	2	3
β-strand	49-53	5	3
α-helix	64-77	14
α-helix	87-88	2
α-helix	90-103	14
β-strand	107-109	3	3
α-helix	111-113	3
β-strand	115	1	3
β-strand	122-127	6	3
α-helix	128-129	2

Chain F: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	24-33	10
β-strand	41-42	2	4
β-strand	49-53	5	4
α-helix	64-67	4
α-helix	69-77	9
α-helix	87-88	2
α-helix	90-103	14
β-strand	107-109	3	4
β-strand	122-127	6	4
α-helix	128-129	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon regulatory factor 4	A, B, D, F	protein	123	Homo sapiens	Q15306 (AlphaFold model)
DNA (5'-d(ptpcpapapcptpgpapapapcptpgpapgpapapapgpc)-3')	C, G	DNA	20	Homo sapiens
DNA (5'-d(papgpcptptptpcptpcpapgptptptpcpapgptptpg)-3')	E, H	DNA	20	Homo sapiens

Sequence of entity 1 (A, B, D, F), FASTA

>9TOY_1 Interferon regulatory factor 4 (chains A, B, D, F)
GPGGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWAL
FKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGA
KQL

Sequence of entity 2 (C, G), FASTA

>9TOY_2 DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*TP*GP*AP*GP*AP*AP*AP*GP*C)-3') (chains C, G)
TCAACTGAAACTGAGAAAGC

Sequence of entity 3 (E, H), FASTA

>9TOY_3 DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*AP*GP*TP*TP*TP*CP*AP*GP*TP*TP*G)-3') (chains E, H)
AGCTTTCTCAGTTTCAGTTG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5

Primary citation

Phosphorus and sulfur SAD phasing of the nucleic acid-bound DNA-binding domain of interferon regulatory factor 4. Agnarelli, A., El Omari, K., Duman, R. et al. Acta Crystallogr F Struct Biol Commun (2021) 77:202-207. DOI 10.1107/S2053230X21006506 · PubMed

Other PDB entries of the same protein (UniProt Q15306 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TD4 1.71 Å, IRF4 DNA-binding domain surface entropy mutant apo structure
9VEH 2.0 Å, The MIDN Catch-IRF4 (A8M) fusion protein
9VE3 2.1 Å, The MIDN Catch-IRF4 (V2L) fusion protein
9VE7 2.15 Å, The MIDN Catch-IRF4 (A8V) fusion protein
7OOT 2.25 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7OGS 2.37 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7RH2 2.47 Å, IRF4 Transcription factor mutant -K59R
9CUG 2.49 Å, X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain
9VE4 2.55 Å, The MIDN Catch-IRF4 fusion protein
7O56 2.6 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
9VE6 2.8 Å, The MIDN Catch-IRF4 (F6Y) fusion protein
9VE8 2.85 Å, The MIDN Catch-IRF4 (A8L) fusion protein

Browse structure collections

About this viewer

MolViewer shows 9TOY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.