Human Prolyl-tRNA Synthetase in Complex with L-proline and Compound 4d. Determined by X-ray diffraction at 2.46 Å resolution. Released 28 Jul 2021.
Explore 7OSZ in 3D Show helices and sheets RCSB PDB PDBe
7OSZ contains 46 α-helices and 64 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1024-1034 | 11 | |
| β-strand | 1038-1040 | 3 | 1 |
| β-strand | 1047-1049 | 3 | 1 |
| α-helix | 1051-1070 | 20 | |
| β-strand | 1074-1075 | 2 | 2 |
| β-strand | 1077 | 1 | 3 |
| β-strand | 1081-1082 | 2 | 4 |
| α-helix | 1084-1088 | 5 | |
| α-helix | 1093-1096 | 4 | |
| β-strand | 1102-1107 | 6 | 4 |
| β-strand | 1110-1118 | 9 | 4 |
| α-helix | 1123-1133 | 11 | |
| α-helix | 1137-1139 | 3 | |
| α-helix | 1140-1141 | 2 | |
| β-strand | 1142-1151 | 10 | 2 |
| β-strand | 1159 | 1 | 5 |
| β-strand | 1163 | 1 | 5 |
| β-strand | 1166-1176 | 11 | 2 |
| α-helix | 1179-1195 | 17 | |
| α-helix | 1196-1200 | 5 | |
| β-strand | 1206-1209 | 4 | 2 |
| β-strand | 1221-1228 | 8 | 2 |
| β-strand | 1235-1245 | 11 | 2 |
| α-helix | 1247-1251 | 5 | |
| β-strand | 1255-1257 | 3 | 6 |
| β-strand | 1265-1267 | 3 | 6 |
| α-helix | 1268 | 1 | |
| β-strand | 1269-1276 | 8 | 2 |
| α-helix | 1278-1287 | 10 | |
| β-strand | 1289 | 1 | 7 |
| β-strand | 1292 | 1 | 7 |
| β-strand | 1304-1308 | 5 | 8 |
| α-helix | 1320-1336 | 17 | |
| β-strand | 1341-1343 | 3 | 8 |
| α-helix | 1351-1361 | 11 | |
| β-strand | 1365-1369 | 5 | 8 |
| α-helix | 1371-1375 | 5 | |
| β-strand | 1378-1383 | 6 | 8 |
| β-strand | 1389-1393 | 5 | 8 |
| α-helix | 1394-1396 | 3 | |
| α-helix | 1397-1423 | 27 | |
| β-strand | 1424-1426 | 3 | 9 |
| α-helix | 1430-1437 | 8 | |
| β-strand | 1442-1447 | 6 | 9 |
| α-helix | 1451-1463 | 13 | |
| β-strand | 1477-1480 | 4 | 9 |
| β-strand | 1481-1482 | 2 | 2 |
| α-helix | 1488-1490 | 3 | |
| α-helix | 1493 | 1 | |
| β-strand | 1494 | 1 | 10 |
| α-helix | 1495 | 1 | |
| β-strand | 1501 | 1 | 10 |
| α-helix | 1502 | 1 | |
| β-strand | 1504-1509 | 6 | 9 |
| β-strand | 1511 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1024-1034 | 11 | |
| β-strand | 1038-1039 | 2 | 3 |
| β-strand | 1048-1049 | 2 | 3 |
| α-helix | 1051-1070 | 20 | |
| β-strand | 1074-1075 | 2 | 11 |
| β-strand | 1077 | 1 | 1 |
| β-strand | 1081-1082 | 2 | 4 |
| α-helix | 1084-1087 | 4 | |
| α-helix | 1091-1097 | 7 | |
| α-helix | 1098-1100 | 3 | |
| β-strand | 1102-1107 | 6 | 4 |
| β-strand | 1110-1118 | 9 | 4 |
| α-helix | 1123-1133 | 11 | |
| α-helix | 1137-1139 | 3 | |
| β-strand | 1142-1151 | 10 | 11 |
| α-helix | 1157-1158 | 2 | |
| β-strand | 1159 | 1 | 12 |
| β-strand | 1163 | 1 | 12 |
| β-strand | 1166-1176 | 11 | 11 |
| α-helix | 1179-1195 | 17 | |
| α-helix | 1196-1200 | 5 | |
| β-strand | 1206-1209 | 4 | 11 |
| α-helix | 1216 | 1 | |
| β-strand | 1221-1228 | 8 | 11 |
| β-strand | 1235-1245 | 11 | 11 |
| α-helix | 1247-1252 | 6 | |
| β-strand | 1255-1257 | 3 | 13 |
| β-strand | 1265-1267 | 3 | 13 |
| α-helix | 1268 | 1 | |
| β-strand | 1269-1276 | 8 | 11 |
| α-helix | 1278-1287 | 10 | |
| β-strand | 1289 | 1 | 14 |
| β-strand | 1292 | 1 | 14 |
| β-strand | 1304-1308 | 5 | 15 |
| α-helix | 1317-1335 | 19 | |
| β-strand | 1341-1343 | 3 | 15 |
| α-helix | 1351-1360 | 10 | |
| β-strand | 1365-1369 | 5 | 15 |
| α-helix | 1371-1375 | 5 | |
| β-strand | 1378-1383 | 6 | 15 |
| β-strand | 1389-1393 | 5 | 15 |
| α-helix | 1397-1423 | 27 | |
| β-strand | 1424-1426 | 3 | 16 |
| α-helix | 1430-1438 | 9 | |
| β-strand | 1442-1447 | 6 | 16 |
| α-helix | 1451-1461 | 11 | |
| β-strand | 1477-1480 | 4 | 16 |
| β-strand | 1481-1482 | 2 | 11 |
| α-helix | 1488-1490 | 3 | |
| α-helix | 1493 | 1 | |
| β-strand | 1494 | 1 | 17 |
| α-helix | 1495 | 1 | |
| β-strand | 1501 | 1 | 17 |
| β-strand | 1504-1509 | 6 | 16 |
| β-strand | 1511 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bifunctional glutamate/proline--tRNA ligase | A, B | protein | 512 | Homo sapiens | P07814 (AlphaFold model) |
>7OSZ_1 Bifunctional glutamate/proline--tRNA ligase (chains A, B) GAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAI KDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRP TSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATME EAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGT SHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVA CVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWEL KGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDL KTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLC IPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
| ID | Name | Formula | Copies |
|---|---|---|---|
| PRO | Proline | C5 H9 N O2 | 2 |
| 0X7 | 3-[(2-methylphenyl)methylamino]pyrazine-2-carboxamide | C13 H14 N4 O | 2 |
| ZN | Zinc ion | Zn | 2 |
| SR | Strontium ion | Sr | 7 |
Towards Novel 3-Aminopyrazinamide-Based Prolyl-tRNA Synthetase Inhibitors: In Silico Modelling, Thermal Shift Assay and Structural Studies. Pang, L., Weeks, S.D., Juhas, M. et al. Int J Mol Sci (2021) 22. DOI 10.3390/ijms22157793 · PubMed
Other PDB entries of the same protein (UniProt P07814 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7OSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.