7OVC: Human UFC1 protein

Structure of the human UFC1 protein in complex with the UBA5 C-terminal UFC1-binding motif. Determined by solution NMR. Released 4 Aug 2021.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,580
Mol. weight: 22.52 kDa
Released: 4 Aug 2021

Explore 7OVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OVC contains 10 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	14-15	2
α-helix	25-48	24
β-strand	54-58	5	1
β-strand	64-73	10	1
β-strand	76-85	10	1
α-helix	100-102	3
β-strand	103	1	2
β-strand	106	1	2
α-helix	121-127	7
α-helix	134-137	4
α-helix	138-142	5
α-helix	143-156	14
α-helix	163-165	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	394-404	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-fold modifier-conjugating enzyme 1	A	protein	167	Homo sapiens	Q9Y3C8 (AlphaFold model)
Ubiquitin-like modifier-activating enzyme 5	B	protein	27	Homo sapiens	Q9GZZ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7OVC_1 Ubiquitin-fold modifier-conjugating enzyme 1 (chains A)
MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNK
EGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDH
FKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ

Sequence of entity 2 (B), FASTA

>7OVC_2 Ubiquitin-like modifier-activating enzyme 5 (chains B)
GMSVTELTVEDSGESLEDLMAKMKNMW

Primary citation

A Concerted Action of UBA5 C-Terminal Unstructured Regions Is Important for Transfer of Activated UFM1 to UFC1. Wesch, N., Lohr, F., Rogova, N. et al. Int J Mol Sci (2021) 22. DOI 10.3390/ijms22147390 · PubMed

Other PDB entries of the same protein (UniProt Q9Y3C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GLH 1.11 Å, Crystal Structure of UFC1 T106S
9GLJ 1.21 Å, Crystal Structure of UFC1 T106A
9GMM 1.35 Å, Crystal Structure of UFC1 T106I
9GLI 1.43 Å, Crystal Structure of UFC1 T106C
9GLO 1.53 Å, Crystal Structure of UFC1 C116E&T106S
9I9M 1.54 Å, Crystal structure of chimeric UFC1, TAK MotiF replaced with HPN motif of other E2 proteins
2Z6O 1.6 Å, Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1
9GLL 1.65 Å, Crystal Structure of UFC1 T106L
9GLP 1.77 Å, Crystal Structure of UFC1 C116E&T106I
8BZR 1.78 Å, UFC1-UFM1 conjugate
9GLM 1.79 Å, Crystal Structure of UFC1 W145F
2Z6P 1.8 Å, Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1

Browse structure collections

About this viewer

MolViewer shows 7OVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.