7P0L: S.pombe Mdb1 BRCT domains

Crystal structure of S.pombe Mdb1 BRCT domains in complex with a H2A phosphopeptide. Determined by X-ray diffraction at 1.97 Å resolution. Released 1 Dec 2021.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 4
Atoms: 3,284
Mol. weight: 47.88 kDa
Released: 1 Dec 2021

Explore 7P0L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P0L contains 29 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	388-392	5	1
α-helix	395-397	3
α-helix	398-406	9
β-strand	410-411	2	1
β-strand	421-424	4	1
α-helix	425	1
α-helix	429-430	2
β-strand	432	1	2
α-helix	433-441	9
β-strand	445-447	3	1
α-helix	449-457	9
α-helix	463-466	4
β-strand	467	1	1
α-helix	471-477	7
β-strand	494-497	4	3
α-helix	499-503	5
α-helix	508-519	12
β-strand	523-524	2	3
α-helix	528-531	4
β-strand	536-540	5	3
α-helix	546-552	7
β-strand	558-560	3	3
α-helix	562-570	9
α-helix	575-578	4
β-strand	579	1	3

Chain B: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	388-392	5	4
α-helix	395-397	3
α-helix	398-404	7
β-strand	410-412	3	4
β-strand	419-424	6	4
α-helix	425	1
β-strand	432	1	5
α-helix	433-441	9
α-helix	443-444	2
β-strand	445-447	3	4
α-helix	448-457	10
α-helix	463-466	4
β-strand	467	1	4
α-helix	471-477	7
β-strand	494-497	4	6
α-helix	499-505	7
α-helix	508-519	12
β-strand	523-524	2	6
α-helix	528-533	6
β-strand	537-540	4	6
α-helix	546-552	7
β-strand	558-560	3	6
α-helix	562-570	9
α-helix	575-578	4
β-strand	579	1	6

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	128-130	3
β-strand	131	1	2

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	131	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA damage response protein Mdb1	A, B	protein	199	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O14079 (AlphaFold model)
Histone H2A-beta	C, D	protein	11	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	P04910 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7P0L_1 DNA damage response protein Mdb1 (chains A, B)
MNKHTNLVTSSFNLTKPMKSFIRRNGLRVQESVTDETDFVILGSPPLRRTHKFLLATSLG
IPLVSSQYLTDCIKSGKVLDFRSYKYKDEEAEAKWGFRLDDIHRRTCFNGKRLYITKAIR
DSMVGDSIHGLYSILETSGAEIVGDIKRAQEKDTIILAQPDNDQEGRNMSATGLNVYKIE
LVALSILRDRIDFDEFLID

Sequence of entity 2 (C, D), FASTA

>7P0L_2 Histone H2A-beta (chains C, D)
SGRTGKPSQEL

Primary citation

Phosphorylation-dependent assembly of DNA damage response systems and the central roles of TOPBP1. Day, M., Oliver, A.W., Pearl, L.H. DNA Repair (Amst) (2021) 108:103232-103232. DOI 10.1016/j.dnarep.2021.103232 · PubMed

Other PDB entries of the same protein (UniProt O14079 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P0J 1.48 Å, Crystal structure of S.pombe Mdb1 BRCT domains
6HM4 1.77 Å, Crystal structure of Rad4 BRCT1,2 in complex with a Mdb1 phosphopeptide
4S3H 2.7 Å, Crystal structure of S. pombe Mdb1 FHA domain

Browse structure collections

About this viewer

MolViewer shows 7P0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.