Crystal Structure of leukotoxin LukE from Staphylococcus aureus at 1.9 Angstrom resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 Apr 2022.
Explore 7P8S in 3D Show helices and sheets RCSB PDB PDBe
7P8S contains 6 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-16 | 3 | |
| α-helix | 17-19 | 3 | |
| β-strand | 32-36 | 5 | 1 |
| β-strand | 39-50 | 12 | 1 |
| β-strand | 55-66 | 12 | 1 |
| β-strand | 72-83 | 12 | 1 |
| β-strand | 87-90 | 4 | 2 |
| α-helix | 91-92 | 2 | |
| β-strand | 99-114 | 16 | 2 |
| β-strand | 119-125 | 7 | 1 |
| β-strand | 130 | 1 | 2 |
| β-strand | 134-142 | 9 | 3 |
| β-strand | 146-150 | 5 | 3 |
| β-strand | 161-168 | 8 | 3 |
| β-strand | 172-179 | 8 | 2 |
| β-strand | 183-190 | 8 | 2 |
| β-strand | 192-193 | 2 | 4 |
| β-strand | 200-201 | 2 | 4 |
| β-strand | 209 | 1 | 5 |
| α-helix | 219-222 | 4 | |
| β-strand | 223 | 1 | 5 |
| α-helix | 226-228 | 3 | |
| α-helix | 231-234 | 4 | |
| β-strand | 236-237 | 2 | 1 |
| β-strand | 241-247 | 7 | 1 |
| β-strand | 254-273 | 20 | 2 |
| β-strand | 277-299 | 23 | 2 |
| β-strand | 304-308 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leucotoxin LukEv | A | protein | 308 | Staphylococcus aureus | Q2FXB0 (AlphaFold model) |
>7P8S_1 Leucotoxin LukEv (chains A) MSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQFDFVKDKKYN KDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVSLINYLPKNKI ETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQNSKSVKWGVKA NEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPSFITTLSHEKG SSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNWKTHEIKVKGH NKHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| MHA | (carbamoylmethyl-carboxymethyl-amino)-acetic acid | C6 H10 N2 O5 | 1 |
Water and common crystallization additives (P6G, SO4) are not listed.
Structural insights into recognition of chemokine receptors by Staphylococcus aureus leukotoxins. Lambey, P., Otun, O., Cong, X. et al. Elife (2022) 11. DOI 10.7554/eLife.72555 · PubMed
Other PDB entries of the same protein (UniProt Q2FXB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7P8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.