7PB4: Cenp-HIK 3-protein complex

Cenp-HIK 3-protein complex. Determined by X-ray diffraction at 2.49 Å resolution. Released 27 Apr 2022.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,864
Mol. weight: 44.06 kDa
Released: 27 Apr 2022

Explore 7PB4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PB4 contains 21 α-helices and 7 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	201-223	23
α-helix	231-237	7

Chain I: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	65-74	10
α-helix	84-101	18
β-strand	104	1	1
α-helix	106-116	11
α-helix	123-131	9
β-strand	135	1	1
β-strand	139	1	2
α-helix	141-153	13
α-helix	158-170	13
α-helix	172-174	3
β-strand	175	1	2
α-helix	179-182	4
α-helix	185-189	5
α-helix	190-192	3
α-helix	198-208	11
α-helix	211-213	3
α-helix	216-229	14
α-helix	233-245	13
α-helix	272-280	9

Chain K: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	166-187	22
α-helix	209-211	3
α-helix	212-225	14
β-strand	232-233	2	3
α-helix	240-248	9
β-strand	252-254	3	3
β-strand	261-264	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere protein H	H	protein	49	Homo sapiens	Q9H3R5 (AlphaFold model)
Centromere protein I	I	protein	227	Homo sapiens	Q92674 (AlphaFold model)
Centromere protein K	K	protein	105	Homo sapiens	Q9BS16 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>7PB4_1 Centromere protein H (chains H)
RQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM

Sequence of entity 2 (I), FASTA

>7PB4_2 Centromere protein I (chains I)
MDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFG
NAVNTRILKCMIPATVISEDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQIN
LLYGFFFASLQDDALCPYVCHLLYLLTKKENVKPFRVRKLLDLQAKMGMQPHLQALLSLY
KFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRNRSPLEVQFG

Sequence of entity 3 (K), FASTA

>7PB4_3 Centromere protein K (chains K)
KMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLF
DVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ

Primary citation

Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome. Yatskevich, S., Muir, K.W., Bellini, D. et al. Science (2022) 376:844-852. DOI 10.1126/science.abn3810 · PubMed

Other PDB entries of the same protein (UniProt Q9H3R5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
7R5S 2.83 Å, Structure of the human CCAN bound to alpha satellite DNA
7PKN 3.2 Å, Structure of the human CCAN deltaCT complex
7XHO 3.29 Å, Structure of human inner kinetochore CCAN complex
9TAW 3.54 Å, Structure of the human inner kinetochore CCAN bound to DNA
7XHN 3.71 Å, Structure of human inner kinetochore CCAN-DNA complex
9TAX 4.5 Å, Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome
7R5V 4.55 Å, Structure of the human CCAN CENP-A alpha-satellite complex
7QOO 4.6 Å, Structure of the human inner kinetochore CCAN complex
7YYH 8.9 Å, Structure of the human CCANdeltaT CENP-A alpha-satellite complex
7YWX 12.0 Å, Structure of the human CCAN CENP-A alpha-satellite complex
9TAY 15.5 Å, Structure of the human inner kinetochore CCAN bound to a di-CENP-A nucleosome

Browse structure collections

About this viewer

MolViewer shows 7PB4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.