7PC4: The PDZ domain of SNTB1

The PDZ domain of SNTB1 complexed with the PDZ-binding motif of HTLV1-TAX1. Determined by X-ray diffraction at 2.3 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Homo sapiens, HTLV-1 subtype A
Chains: 2
Atoms: 3,370
Mol. weight: 48.29 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7PC4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PC4 contains 24 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	111-116	6	1
β-strand	118	1	2
β-strand	122	1	2
β-strand	125-130	6	1
α-helix	131-133	3
β-strand	135-142	8	1
α-helix	147-151	5
β-strand	158-163	6	1
β-strand	166-167	2	1
α-helix	173-182	10
β-strand	186-193	8	1
α-helix	204-206	3
α-helix	211-223	13
α-helix	229-236	8
α-helix	241-255	15
α-helix	259-266	8
α-helix	269-279	11
α-helix	282-294	13
α-helix	301-310	10
α-helix	313-327	15
α-helix	331-338	8
α-helix	341-351	11
α-helix	355-357	3
α-helix	364-377	14
α-helix	386-395	10
α-helix	398-411	14
α-helix	416-423	8
α-helix	426-455	30
α-helix	461-470	10
α-helix	476-487	12
α-helix	491-498	8
α-helix	501-511	11

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	196-197	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-1-syntrophin,Annexin A2	A	protein	414	Homo sapiens	P07355 (AlphaFold model), Q13884 (AlphaFold model)
Protein Tax-1	C	protein	10	HTLV-1 subtype A	P03409

Sequence of entity 1 (A), FASTA

>7PC4_1 Beta-1-syntrophin,Annexin A2 (chains A)
GSHMGSNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAIL
SVNGADLRDATHDEAVQALKRAGKEVLLEVKYMREGSAYGSVKAYTNFDAERDALNIETA
IKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKT
PAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSG
DFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHL
QKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRD
KVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Sequence of entity 2 (C), FASTA

>7PC4_2 Protein Tax-1 (chains C)
SEKHFRETEV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5

Water and common crystallization additives (EDO) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 7PC4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.