7PC7: The PDZ domain of SNTG1

The PDZ domain of SNTG1 complexed with the acetylated PDZ-binding motif of PTEN. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,965
Mol. weight: 96.87 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7PC7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PC7 contains 49 α-helices and 15 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	56-61	6	1
β-strand	70-73	4	1
α-helix	76-78	3
α-helix	81-82	2
β-strand	83-87	5	1
α-helix	89-94	6
β-strand	96	1	1
β-strand	103-108	6	1
β-strand	111-112	2	1
α-helix	118-126	9
β-strand	131-138	8	1
α-helix	157-169	13
α-helix	175-182	8
α-helix	187-201	15
α-helix	205-212	8
α-helix	215-225	11
α-helix	228-240	13
α-helix	247-256	10
α-helix	259-273	15
α-helix	277-284	8
α-helix	287-297	11
α-helix	301-305	5
α-helix	310-323	14
α-helix	332-341	10
α-helix	344-357	14
α-helix	362-369	8
α-helix	372-400	29
α-helix	407-417	11
α-helix	422-433	12
α-helix	437-444	8
α-helix	447-457	11

Chain B: 24 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	56-61	6	2
α-helix	62-63	2
β-strand	70-75	6	2
α-helix	76-78	3
β-strand	80-87	8	2
α-helix	89-95	7
β-strand	103-108	6	2
β-strand	111-112	2	2
α-helix	118-126	9
β-strand	131-138	8	2
α-helix	157-169	13
α-helix	175-182	8
α-helix	187-201	15
α-helix	205-212	8
α-helix	215-225	11
α-helix	228-240	13
α-helix	247-256	10
α-helix	259-273	15
α-helix	277-284	8
α-helix	287-297	11
α-helix	301-304	4
α-helix	310-323	14
α-helix	332-341	10
α-helix	344-357	14
α-helix	362-369	8
α-helix	372-401	30
α-helix	407-417	11
α-helix	422-433	12
α-helix	437-444	8
α-helix	447-457	11

Chain E: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	94-96	3
β-strand	97-99	3	1

Chain F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	64-65	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-1-syntrophin,Annexin A2	A, B	protein	414	Homo sapiens	P07355 (AlphaFold model), Q9NSN8 (AlphaFold model)
Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN	E, F	protein	10	Homo sapiens	P60484 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7PC7_1 Gamma-1-syntrophin,Annexin A2 (chains A, B)
GSHMGGERTVTIRRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQI
NGINVRKCRHEEVVQVLRNAGEEVTLTVSFLKRAPGSAYGSVKAYTNFDAERDALNIETA
IKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKT
PAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSG
DFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHL
QKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRD
KVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Sequence of entity 2 (E, F), FASTA

>7PC7_2 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (chains E, F)
EDQHTQITKV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	12

Water and common crystallization additives (GOL) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 7PC7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.