Structure of dark-adapted AsLOV2 wild type. Determined by X-ray diffraction at 1.0 Å resolution. Released 11 May 2022.
Explore 7PGX in 3D Show helices and sheets RCSB PDB PDBe
7PGX contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 404-406 | 3 | |
| α-helix | 408-410 | 3 | |
| β-strand | 415-418 | 4 | 1 |
| β-strand | 427-430 | 4 | 1 |
| α-helix | 432-438 | 7 | |
| α-helix | 450-453 | 4 | |
| α-helix | 460-471 | 12 | |
| β-strand | 476-483 | 8 | 1 |
| β-strand | 489-500 | 12 | 1 |
| β-strand | 506-516 | 11 | 1 |
| α-helix | 522-543 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NPH1-1 | AAA | protein | 146 | Avena sativa | O49003 (AlphaFold model) |
>7PGX_1 NPH1-1 (chains AAA) GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDR ATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHV RDAAEREGVMLIKKTAENIDEAAKEL
Water and common crystallization additives (ACT, EDO, PEG, GOL, CL) are not listed.
Signal transduction in light-oxygen-voltage receptors lacking the active-site glutamine. Dietler, J., Gelfert, R., Kaiser, J. et al. Nat Commun (2022) 13:2618-2618. DOI 10.1038/s41467-022-30252-4 · PubMed
Other PDB entries of the same protein (UniProt O49003 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7PGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.