7PQV: MEK1

MEK1 in complex with compound 7. Determined by X-ray diffraction at 2.13 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 2.13 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,674
Mol. weight: 39.02 kDa
Ligands: 80C, CA, MG
Released: 16 Mar 2022

Explore 7PQV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PQV contains 19 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	44-58	15
α-helix	65-67	3
β-strand	68-76	9	1
β-strand	81-87	7	1
β-strand	92-100	9	1
α-helix	105-114	10
α-helix	115-119	5
β-strand	126	1	2
β-strand	129-134	6	1
β-strand	138-143	6	1
β-strand	150	1	2
α-helix	151-158	8
α-helix	163-184	22
α-helix	193-195	3
β-strand	196-198	3	2
β-strand	204-206	3	2
α-helix	213-219	7
α-helix	232-235	4
α-helix	243-258	16
α-helix	265-267	3
α-helix	268-274	7
α-helix	310-319	10
α-helix	321-323	3
α-helix	325-326	2
α-helix	332-341	10
α-helix	352-356	5
α-helix	359-366	8
α-helix	371-379	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity mitogen-activated protein kinase kinase 1	A	protein	344	Homo sapiens	Q02750 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7PQV_1 Dual specificity mitogen-activated protein kinase kinase 1 (chains A)
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKL
IHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKA
GRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQ
VEGDAAETPPRPRTPGRPLNKFGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFV
NKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN

Ligands and cofactors

ID	Name	Formula	Copies
80C	8-(2-chloranyl-4-methoxy-phenyl)-7-fluoranyl-1-piperidin-4-yl-imidazo[4,5-c]qui…	C22 H20 Cl F N4 O	1
CA	Calcium ion	Ca	2
MG	Magnesium ion	Mg	1

Primary citation

Discovery of MAP855, an Efficacious and Selective MEK1/2 Inhibitor with an ATP-Competitive Mode of Action. Poddutoori, R., Aardalen, K., Aithal, K. et al. J Med Chem (2022) 65:4350-4366. DOI 10.1021/acs.jmedchem.1c02192 · PubMed

Other PDB entries of the same protein (UniProt Q02750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B7R 1.7 Å, MEK1 in complex with compound 4
7B9L 1.7 Å, MEK1 in complex with compound 23
3EQC 1.8 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3EQI 1.9 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3EQH 2.0 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
3VVH 2.0 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in complex…
7B94 2.0 Å, MEK1 in complex with compound 6
7F2X 2.01 Å, Crystal structure of MEK1 C121S mutant
9AXX 2.07 Å, Crystal structure of BRAF/MEK1 complex with NST-628 and an active RAF dimer
3EQD 2.1 Å, X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a…
4AN3 2.1 Å, Crystal structures of human MEK1 with carboxamide-based allosteric inhibitor XL518…
7XLP 2.1 Å, MEK1 bound to DS03090629

Browse structure collections

About this viewer

MolViewer shows 7PQV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.