7PUS: ERK5

ERK5 in complex with Pyrrole Carboxamide scaffold. Determined by X-ray diffraction at 2.59 Å resolution. Released 11 May 2022.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,782
Mol. weight: 41.44 kDa
Ligands: 86E
Released: 11 May 2022

Explore 7PUS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PUS contains 27 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 27 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	55-62	8	1
β-strand	68-74	7	1
β-strand	80-86	7	1
α-helix	93-108	16
β-strand	114	1	2
β-strand	117-120	4	1
α-helix	121-123	3
α-helix	127-129	3
β-strand	133-137	5	1
β-strand	142-143	2	2
α-helix	144-148	5
α-helix	156-175	20
β-strand	179	1	3
α-helix	185-187	3
β-strand	188-190	3	2
β-strand	196-198	3	2
β-strand	205	1	3
α-helix	214-216	3
α-helix	219-221	3
α-helix	225-227	3
α-helix	230-234	5
α-helix	242-257	16
α-helix	267-278	12
α-helix	281-282	2
α-helix	283-288	6
α-helix	292-299	8
α-helix	302-303	2
α-helix	305-308	4
α-helix	309-312	4
α-helix	318-327	10
α-helix	332-334	3
α-helix	336-337	2
α-helix	338-343	6
α-helix	345-347	3
α-helix	353-355	3
α-helix	362-363	2
α-helix	366-369	4
α-helix	374-392	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 7	AAA	protein	358	Homo sapiens	Q13164 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>7PUS_1 Mitogen-activated protein kinase 7 (chains AAA)
GDVTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELK
ILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLY
QLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVAT
RWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPA
VIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRH
PFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQ

Ligands and cofactors

ID	Name	Formula	Copies
86E	4-[3,6-bis(chloranyl)-2-fluoranyl-phenyl]carbonyl-~{N}-(1-methylpyrazol-4-yl)-1…	C16 H11 Cl2 F N4 O2	1

Primary citation

Parallel Optimization of Potency and Pharmacokinetics Leading to the Discovery of a Pyrrole Carboxamide ERK5 Kinase Domain Inhibitor. Miller, D.C., Reuillon, T., Molyneux, L. et al. J Med Chem (2022) 65:6513-6540. DOI 10.1021/acs.jmedchem.1c01756 · PubMed

Other PDB entries of the same protein (UniProt Q13164 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BYZ 1.65 Å, ERK5 in complex with small molecule
4ZSG 1.79 Å, Mitogen activated protein kinase 7 in complex with inhibitor
2Q8Y 2.0 Å, Structural insight into the enzymatic mechanism of the phophothreonine lyase
4ZSL 2.25 Å, Mitogen activated protein kinase 7 in complex with inhibitor
6HKN 2.33 Å, Crystal structure of Compound 35 with ERK5
9LTA 2.33 Å, Crystal Structure of Compound SKLB-D18 with MAPK7 (ERK5)
5O7I 2.38 Å, ERK5 in complex with a pyrrole inhibitor
6HKM 2.47 Å, Crystal structure of Compound 1 with ERK5
4ZSJ 2.48 Å, Mitogen activated protein kinase 7 in complex with inhibitor
4IC7 2.6 Å, Crystal structure of the ERK5 kinase domain in complex with an MKK5 binding fragment
5BYY 2.79 Å, ERK5 in complex with small molecule
4B99 2.8 Å, Crystal Structure of MAPK7 (ERK5) with inhibitor

Browse structure collections

About this viewer

MolViewer shows 7PUS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.