7PUY: Glycoprotein G2

Structure of the membrane soluble spike complex from the Lassa virus in a C3-symmetric map. Determined by electron microscopy at 3.3 Å resolution. Released 29 Dec 2021.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976)
Chains: 6
Atoms: 10,395
Mol. weight: 179.96 kDa
Ligands: NAG
Released: 29 Dec 2021

Explore 7PUY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PUY contains 57 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a, b and c: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	266-268	3
β-strand	279-280	2	1
β-strand	285	1	2
β-strand	291-292	2	1
α-helix	295-299	5
α-helix	300-302	3
α-helix	309-324	16
α-helix	334-344	11
α-helix	349-359	11
β-strand	363-374	12	3
α-helix	381-383	3
β-strand	384-389	6	3
β-strand	392-393	2	3
α-helix	394-395	2
α-helix	400-425	26
α-helix	428-447	20

Chains A, B and C: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	15-34	20
β-strand	61-62	2	3
β-strand	66-72	7	3
β-strand	73	1	2
α-helix	75-78	4
β-strand	84-87	4	10
β-strand	92-97	6	10
β-strand	101-108	8	10
α-helix	120-125	6
α-helix	131-142	12
β-strand	154-156	3	10
α-helix	158-160	3
β-strand	163-167	5	10
α-helix	183-194	12
β-strand	219-225	7	10
β-strand	237	1	10
α-helix	239-247	9
α-helix	252-254	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein G2	a, b, c	protein	244	Lassa virus (strain Mouse/Sierra Leone/Josiah/1976)	P08669 (AlphaFold model)
Pre-glycoprotein polyprotein GP complex	A, B, C	protein	259	Lassa virus (strain Mouse/Sierra Leone/Josiah/1976)	P08669 (AlphaFold model)

Sequence of entity 1 (a, b, c), FASTA

>7PUY_1 Glycoprotein G2 (chains a, b, c)
GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFN
KQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGR
TSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTS
FYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKRGGGSDYKD
DDDK

Sequence of entity 2 (A, B, C), FASTA

>7PUY_2 Pre-glycoprotein polyprotein GP complex (chains A, B, C)
MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLVTFLLLCGRSCTTS
LYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNL
SDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHC
GTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIG
YLGLLSQRTRDIYISRRLL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	15

Primary citation

Structure and receptor recognition by the Lassa virus spike complex. Katz, M., Weinstein, J., Eilon-Ashkenazy, M. et al. Nature (2022) 603:174-179. DOI 10.1038/s41586-022-04429-2 · PubMed

Other PDB entries of the same protein (UniProt P08669 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MJ1 1.9 Å, Native tagless Lassa virus spike complex bound at pH 8.0
9MHE 2.01 Å, Native tagless Lassa virus spike complex bound to ARN-75039 at pH 8.0
9MIV 2.02 Å, Native tagless Lassa virus spike complex pH 6.0
5OMI 2.56 Å, Crystal structure of GP2 from Lassa virus in a post fusion conformation
9MJ2 2.58 Å, Flag-tag Lassa virus spike complex at pH 6.0
4ZJF 2.6 Å, Crystal structure of GP1 - the receptor binding domain of Lassa virus
7S8H 2.7 Å, Structure of Lassa virus glycoprotein bound to Fab 18.5C and Fab 36.1F
9MIY 2.72 Å, Focused reconstruction of the transmembrane region of the Lassa virus spike complex
7UOV 2.75 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 12.1F and 37.2D
7UOT 2.77 Å, Native Lassa glycoprotein in complex with neutralizing antibodies 8.9F and 37.2D
7TYV 2.8 Å, Structure of Lassa Virus glycoprotein (Josiah) bound to Fab 25.10C
8VCV 2.8 Å, Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody…

Browse structure collections

About this viewer

MolViewer shows 7PUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.