Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#1). Determined by X-ray diffraction at 1.8 Å resolution. Released 11 May 2022.
Explore 7Q2O in 3D Show helices and sheets RCSB PDB PDBe
7Q2O contains 8 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-14 | 3 | |
| β-strand | 17-18 | 2 | 1 |
| β-strand | 20-26 | 7 | 2 |
| α-helix | 29-31 | 3 | |
| β-strand | 41-48 | 8 | 1 |
| β-strand | 54-62 | 9 | 1 |
| β-strand | 65-73 | 9 | 1 |
| β-strand | 74-75 | 2 | 2 |
| β-strand | 81-83 | 3 | 2 |
| β-strand | 90-97 | 8 | 2 |
| β-strand | 102-109 | 8 | 2 |
| β-strand | 116-123 | 8 | 2 |
| α-helix | 130-140 | 11 | |
| β-strand | 147-150 | 4 | 2 |
| α-helix | 153-156 | 4 | |
| α-helix | 159-161 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-18 | 2 | 3 |
| β-strand | 20-26 | 7 | 2 |
| α-helix | 29-31 | 3 | |
| β-strand | 42-48 | 7 | 3 |
| β-strand | 54-60 | 7 | 3 |
| β-strand | 67-73 | 7 | 3 |
| β-strand | 74-75 | 2 | 2 |
| β-strand | 81-83 | 3 | 2 |
| β-strand | 90-97 | 8 | 2 |
| β-strand | 102-109 | 8 | 2 |
| β-strand | 116-123 | 8 | 2 |
| α-helix | 130-140 | 11 | |
| β-strand | 147-150 | 4 | 2 |
| α-helix | 153-157 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-lactoglobulin | AAA, BBB | protein | 162 | Bos taurus | P02754 (AlphaFold model) |
>7Q2O_1 Beta-lactoglobulin (chains AAA, BBB) ASVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPARVYVEELKPTPEGDLEFLLQK WENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCWENSAEPEQSLACQ CLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
| ID | Name | Formula | Copies |
|---|---|---|---|
| DSM | 3-(10,11-dihydro-5H-dibenzo[b,f]azepin-5-yl)-N-methylpropan-1-amine | C18 H22 N2 | 4 |
Water and common crystallization additives (EDO, CL, SO4) are not listed.
New ligand-binding sites identified in the crystal structures of [beta]-lactoglobulin complexes with desipramine. Loch, J.I., Barciszewski, J., Sliwiak, J. et al. IUCrJ (2022) 9:386-398. DOI 10.1107/S2052252522004183
Other PDB entries of the same protein (UniProt P02754 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7Q2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.