7Q33: RBM39 RRM2

Solution structure of RBM39 RRM2 bound to 5'-AGCUUUG-3. Determined by solution NMR. Released 8 Feb 2023.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 873
Mol. weight: 12.64 kDa
Released: 8 Feb 2023

Explore 7Q33 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Q33 contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	250-255	6	1
α-helix	263-270	8
α-helix	271-273	3
β-strand	276-283	8	1
β-strand	290-298	9	1
α-helix	301-311	11
β-strand	314-316	3	2
β-strand	319-321	3	2
β-strand	322-325	4	1
α-helix	330-332	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein 39	A	protein	93	Homo sapiens	Q14498 (AlphaFold model)
RNA (5'-r(apgpcpupupup*g)-3')	B	RNA	7	Homo sapiens

Sequence of entity 1 (A), FASTA

>7Q33_1 RNA-binding protein 39 (chains A)
MAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAK
KALEQLNGFELAGRPMKVGHVTERTDALELVPR

Sequence of entity 2 (B), FASTA

>7Q33_2 RNA (5'-R(*AP*GP*CP*UP*UP*UP*G)-3') (chains B)
AGCUUUG

Primary citation

Molecular basis of RNA-binding and autoregulation by the cancer-associated splicing factor RBM39. Campagne, S., Jutzi, D., Malard, F. et al. Nat Commun (2023) 14:5366-5366. DOI 10.1038/s41467-023-40254-5 · PubMed

Other PDB entries of the same protein (UniProt Q14498 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YUD 1.28 Å, Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A…
4OZ1 1.74 Å, Crystal structure of human CAPERalpha UHM bound to SF3b155 ULM5
4OZ0 2.2 Å, Crystal structure of human CAPERalpha U2AF homology motif (apo-state)
6UD7 2.3 Å, Crystal structure of full-length human DCAF15-DDB1(deltaBPB)-DDA1-RBM39 in complex with…
6UE5 2.61 Å, Crystal structure of full-length human DCAF15-DDB1-deltaPBP-DDA1-RBM39 in complex with…
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
6PAI 2.9 Å, Structure of the human DDB1-DDA1-DCAF15 E3 ubiquitin ligase bound to RBM39 and…
6Q0R 2.9 Å, Structure of DDB1-DDA1-DCAF15 complex bound to E7820 and RBM39
6Q0V 2.9 Å, Structure of DDB1-DDA1-DCAF15 complex bound to tasisulam and RBM39
6Q0W 2.9 Å, Structure of DDB1-DDA1-DCAF15 complex bound to Indisulam and RBM39
6SJ7 3.54 Å, Structure of the human DDB1-DDA1-DCAF15 E3 ubiquitin ligase bound to RBM39 and Indisulam
2JRS Solution NMR Structure of CAPER RRM2 Domain. Northeast Structural Genomics Target HR4730A

Browse structure collections

About this viewer

MolViewer shows 7Q33 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.