7QL6: Acetylcholine receptor subunit alpha

Torpedo muscle-type nicotinic acetylcholine receptor - carbamylcholine-bound conformation. Determined by electron microscopy at 3.23 Å resolution. Released 9 Feb 2022.

Method: Electron microscopy
Resolution: 3.23 Å
Organism: Tetronarce californica
Chains: 5
Atoms: 16,617
Mol. weight: 274.92 kDa
Ligands: CCE, NAG
Released: 9 Feb 2022

Explore 7QL6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QL6 contains 67 α-helices and 87 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	29-44	16	1
β-strand	49-61	13	1
α-helix	63-65	3
β-strand	77-80	4	1
α-helix	82-84	3
β-strand	90-92	3	2
β-strand	97	1	1
β-strand	108-111	4	1
β-strand	115-118	4	1
β-strand	121-127	7	1
β-strand	139-148	10	2
β-strand	156-160	5	1
β-strand	166	1	1
α-helix	170-172	3
β-strand	176-188	13	2
α-helix	197	1
β-strand	198-209	12	2
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-231	12
α-helix	237-239	3
α-helix	242-261	20
α-helix	273-299	27
α-helix	307-309	3
α-helix	310-318	9
α-helix	320-322	3
β-strand	327	1	3
α-helix	381-430	50

Chain B: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-44	16	4
β-strand	49-61	13	4
α-helix	69-72	4
β-strand	77-80	4	4
α-helix	82-84	3
β-strand	90-92	3	5
β-strand	95	1	4
α-helix	106-107	2
β-strand	108-111	4	4
β-strand	115-118	4	4
β-strand	121-127	7	4
β-strand	139-148	10	5
β-strand	156-160	5	4
α-helix	161	1
β-strand	162	1	6
β-strand	169	1	6
β-strand	172	1	7
β-strand	174	1	4
β-strand	186-190	5	5
β-strand	192	1	7
β-strand	193-196	4	5
β-strand	206-215	10	5
α-helix	221-225	5
α-helix	226-240	15
α-helix	248-266	19
α-helix	279-305	27
β-strand	312	1	3
α-helix	316-323	8
α-helix	326-330	5
α-helix	401-459	59

Chain C: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	9-14	6
β-strand	31-46	16	8
β-strand	51-63	13	8
α-helix	71-74	4
β-strand	80-82	3	8
β-strand	92-94	3	9
β-strand	110-112	3	8
β-strand	117-120	4	8
β-strand	123-129	7	8
β-strand	141-150	10	9
β-strand	158-162	5	8
β-strand	164-167	4	10
β-strand	170-173	4	10
β-strand	176	1	11
β-strand	178	1	8
β-strand	180	1	12
β-strand	183	1	12
β-strand	185	1	8
β-strand	190-194	5	9
β-strand	196	1	11
β-strand	197-201	5	9
β-strand	213-223	11	9
α-helix	226-228	3
α-helix	229-233	5
α-helix	234-244	11
α-helix	246-248	3
α-helix	256-276	21
α-helix	287-314	28
α-helix	324-326	3
α-helix	327-333	7
α-helix	334-337	4
α-helix	417-477	61

Chain D: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
β-strand	31-44	14	13
β-strand	49-61	13	13
β-strand	77	1	14
β-strand	80-81	2	15
α-helix	82-84	3
β-strand	91-92	2	16
β-strand	95	1	13
β-strand	107-108	2	15
β-strand	109-110	2	13
β-strand	111	1	14
β-strand	115-118	4	13
β-strand	121-127	7	13
β-strand	139-147	9	16
β-strand	158-160	3	13
β-strand	166	1	13
α-helix	170-172	3
β-strand	176-188	13	16
α-helix	197	1
β-strand	198-209	12	16
α-helix	212-214	3
α-helix	215-219	5
α-helix	220-229	10
α-helix	231-234	4
α-helix	242-263	22
α-helix	273-299	27
α-helix	307-309	3
α-helix	310-314	5
α-helix	315-319	5
α-helix	381-420	40

Chain E: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	29-44	16	17
β-strand	49-61	13	17
α-helix	69-72	4
β-strand	77-81	5	17
α-helix	82-84	3
β-strand	90-92	3	18
β-strand	95	1	17
β-strand	107-111	5	17
β-strand	115-118	4	17
β-strand	121-127	7	17
β-strand	139-148	10	18
β-strand	156-160	5	17
β-strand	162	1	19
β-strand	167	1	19
β-strand	170	1	20
β-strand	179	1	17
β-strand	184-188	5	18
β-strand	190	1	20
β-strand	191-195	5	18
β-strand	207-217	11	18
α-helix	220-222	3
α-helix	223-227	5
α-helix	228-234	7
α-helix	237-242	6
α-helix	251-270	20
α-helix	282-308	27
α-helix	319-323	5
α-helix	324-328	5
α-helix	329-333	5
α-helix	420-469	50

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine receptor subunit alpha	A, D	protein	437	Tetronarce californica	P02710 (AlphaFold model)
Acetylcholine receptor subunit beta	B	protein	469	Tetronarce californica	P02712 (AlphaFold model)
Acetylcholine receptor subunit delta	C	protein	501	Tetronarce californica	P02718 (AlphaFold model)
Acetylcholine receptor subunit gamma	E	protein	489	Tetronarce californica	P02714 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>7QL6_1 Acetylcholine receptor subunit alpha (chains A, D)
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQW
IDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTP
PAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKD
YRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHH
RSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEV
IFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICII
GTVSVFAGRLIELSQEG

Sequence of entity 2 (B), FASTA

>7QL6_2 Acetylcholine receptor subunit beta (chains B)
SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAW
TDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQP
SAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAF
TENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFY
LPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVV
VLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKP
AGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASE
FDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA

Sequence of entity 3 (C), FASTA

>7QL6_3 Acetylcholine receptor subunit delta (chains C)
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDH
AWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTW
LPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIID
PEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLIS
FLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVT
GVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRS
SSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIK
SGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNH
PPAKPFEGDPFDYSSDHPRCA

Sequence of entity 4 (E), FASTA

>7QL6_4 Acetylcholine receptor subunit gamma (chains E)
ENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQW
NDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLP
PAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTE
NGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLV
YFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMN
CVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIK
AEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEAC
NFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPF
PGDPRKYVP

Ligands and cofactors

ID	Name	Formula	Copies
CCE	2-[(aminocarbonyl)oxy]-n,n,n-trimethylethanaminium	C6 H15 N2 O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Conformational transitions and ligand-binding to a muscle-type nicotinic acetylcholine receptor. Zarkadas, E., Pebay-Peyroula, E., Thompson, M.J. et al. Neuron (2022) 110:1358. DOI 10.1016/j.neuron.2022.01.013 · PubMed

Other PDB entries of the same protein (UniProt P02710 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YQN 2.27 Å, Torpedo acetylcholine receptor in complex with Erabutoxin A
7QL5 2.5 Å, Torpedo muscle-type nicotinic acetylcholine receptor - nicotine-bound conformation
7SMM 2.5 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form
7SMT 2.56 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with d-tubocurarine and…
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
8F6Z 2.7 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
7SMQ 2.74 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form with added cholesterol
7SMR 2.77 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with carbachol,…
8F6Y 2.79 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with etomidate,…
9E3E 2.8 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Diliganded State
7QKO 2.9 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Resting conformation
8ESK 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 7QL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.