7QPW: Ribonuclease pancreatic

X-ray structure of the adduct obtained upon reaction of [cis-Rh2(OCOCH3)2(OCOCF3)2] with RNase A (1). Determined by X-ray diffraction at 1.15 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,598
Mol. weight: 28.66 kDa
Ligands: F5I, F3I, F5T
Released: 16 Mar 2022

Explore 7QPW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QPW contains 8 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains AAA and BBB: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
β-strand	13	1	1
α-helix	25-32	8
β-strand	43-47	5	1
α-helix	51-55	5
α-helix	56-59	4
β-strand	61-63	3	2
β-strand	72-74	3	2
β-strand	79-86	8	1
β-strand	91	1	3
β-strand	94	1	3
β-strand	97-104	8	1
β-strand	106-111	6	2
β-strand	116-123	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonuclease pancreatic	AAA, BBB	protein	124	Bos taurus	P61823 (AlphaFold model)

Sequence of entity 1 (AAA, BBB), FASTA

>7QPW_1 Ribonuclease pancreatic (chains AAA, BBB)
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQ
KNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF
DASV

Ligands and cofactors

ID	Name	Formula	Copies
F5I	cis-bis(mi2-acetato-O, O')-tetraaquo-dirhodium(II)	C4 H14 O8 Rh2	1
F3I	(mi2-acetato-O, O')-hexaaquo-dirhodium (II)	C2 H15 O8 Rh2	1
F5T	cis-bis(mi2-acetato-O, O')-(mi2-trifluoroacetato-O, O')-diaquo-dirhodium (II)	C6 H10 F3 O8 Rh2	1

Primary citation

Reactivity of a fluorine-containing dirhodium tetracarboxylate compound with proteins. Loreto, D., Esposito, A., Demitri, N. et al. Dalton Trans (2022) 51:3695-3705. DOI 10.1039/d2dt00082b · PubMed

Other PDB entries of the same protein (UniProt P61823 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ETK 0.85 Å, Atomic resolution structure of RNase A (data collection 1)
6ETL 0.85 Å, Atomic resolution structure of RNase A (data collection 2)
7P4R 0.85 Å, Ultra High Resolution X-ray Structure of Orthorhombic Bovine Pancreatic Ribonuclease at…
1DY5 0.87 Å, Deamidated derivative of bovine pancreatic ribonuclease
6ETM 0.92 Å, Atomic resolution structure of RNase A (data collection 3)
6ETN 0.92 Å, Atomic resolution structure of RNase A (data collection 4)
6ETO 1.02 Å, Atomic resolution structure of RNase A (data collection 5)
6ETP 1.02 Å, Atomic resolution structure of RNase A (data collection 6)
1KF3 1.05 Å, Atomic Resolution Structure of RNase A at pH 5.9
2E3W 1.05 Å, X-ray structure of native RNase A
6ETQ 1.08 Å, Atomic resolution structure of RNase A (data collection 7)
1KF2 1.1 Å, Atomic Resolution Structure of RNase A at pH 5.2

Browse structure collections

About this viewer

MolViewer shows 7QPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.