7RAF: AncAR1-Rev - progesterone - Tif2

AncAR1-Rev - progesterone - Tif2. Determined by X-ray diffraction at 1.55 Å resolution. Released 27 Jul 2022.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Escherichia phage EcSzw-2
Chains: 2
Atoms: 2,415
Mol. weight: 31.32 kDa
Ligands: STR
Released: 27 Jul 2022

Explore 7RAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RAF contains 15 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	674-680	7
α-helix	681-686	6
α-helix	694-695	2
α-helix	697-721	25
α-helix	725-727	3
α-helix	730-757	28
β-strand	762-765	4	1
β-strand	768-770	3	1
α-helix	772-777	6
α-helix	781-797	17
α-helix	801-810	10
α-helix	811-813	3
β-strand	815-817	3	2
α-helix	824-844	21
α-helix	849-882	34
α-helix	884-887	4
α-helix	893-907	15
β-strand	911-913	3	2

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	744-750	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ancestral androgen receptor	A	protein	250	Escherichia phage EcSzw-2
Transcriptional mediator/intermediary factor 2	D	protein	12	Escherichia phage EcSzw-2	Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RAF_1 Ancestral androgen receptor (chains A)
IPIFLSVLQSIEPEVVYAGYDNTQPDTSASLLTSLNELGERQLVRVVKWAKALPGFRNLH
VDDQMTLIQYSWMGVMVFAMGWRSYKNVNSRMLYFAPDLVFNEQRMQKSTMYNLCVRMRH
LSQEFVWLQVTQEEFLCMKALLLFSIIPVEGLKNQKYFDELRMNYIKELDRVISFQGKNP
TSSSQRFYQLTKLLDSLQDLVRKLHQFTFDTFVQSQSLSVEFPEMMSEIISAQVPKILAG
MVKPLLFHKQ

Sequence of entity 2 (D), FASTA

>7RAF_2 Transcriptional mediator/intermediary factor 2 (chains D)
QALLRYLLDKDD

Ligands and cofactors

ID	Name	Formula	Copies
STR	Progesterone	C21 H30 O2	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

AncAR1-Rev - progesterone - Tif2. Colucci, J.K. To be published.

Other PDB entries of the same protein (UniProt Q15596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UP3 1.25 Å, Nuclear receptor DAF-12 from hookworm Ancylostoma ceylanicum in complex with…
7NFB 1.33 Å, ER-PRS*(+) (Y537S) in complex with genistein and SRC-2 coactivator peptide
7NEL 1.45 Å, ER-PRS*(+) (Y537S) in complex with estradiol and SRC-2 coactivator peptide
9QX6 1.46 Å, Crystal structure of RXR alpha LBD bound to a synthetic agonist FN537 and a coactivator…
5DXE 1.5 Å, Estrogen Receptor Alpha Ligand Binding Domain Y537S Mutant in Complex with Stapled…
6LB4 1.5 Å, Crystal structure of dimeric RXR-LBD complexed with NEt-3ME and TIF2 co-activator
7A77 1.5 Å, Crystal structure of RXR alpha LBD in complexes with palmitic acid and GRIP-1 peptide
5APH 1.54 Å, Ligand complex of RORg LBD
6R7K 1.54 Å, Ligand complex of RORg LBD
7RKE 1.55 Å, Estrogen Receptor Alpha Ligand Binding Domain Y537S in Complex with…
7PDQ 1.58 Å, Crystal structure of a mutated form of RXRalpha ligand binding domain in complex with…
6HL1 1.6 Å, Crystal Structure of Farnesoid X receptor (FXR) with bound NCoA-2 peptide and CDCA

Browse structure collections

About this viewer

MolViewer shows 7RAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.