7RNS: PDB entry 7RNS

nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an actin peptide with phosphorylated tyrosine 53. Determined by X-ray diffraction at 1.14 Å resolution. Released 11 Aug 2021.

Method: X-ray diffraction
Resolution: 1.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,269
Mol. weight: 14.95 kDa
Released: 11 Aug 2021

Explore 7RNS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RNS contains 7 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	328-330	3
β-strand	334	1	1
α-helix	340-347	8
α-helix	350-351	2
β-strand	354-359	6	1
α-helix	364-366	3
β-strand	368-374	7	1
β-strand	377-383	7	1
β-strand	384-386	3	2
β-strand	389-391	3	2
α-helix	396	1
β-strand	398	1	2
α-helix	401-410	10
α-helix	413-415	3
β-strand	426-427	2	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	51-53	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Phosphatidylinositol 3-kinase regulatory subunit alpha	A	protein	117	Homo sapiens	P27986 (AlphaFold model)
Actin, alpha skeletal muscle	B	protein	9	Homo sapiens	P68133 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RNS_1 Isoform 2 of Phosphatidylinositol 3-kinase regulatory subunit alpha (chains A)
GSMGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGN
NKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQD

Sequence of entity 2 (B), FASTA

>7RNS_2 Actin, alpha skeletal muscle (chains B)
KDSYVGDEA

Primary citation

The Functional Analysis of a Major Tyrosine Phosphorylation Site on Actin. Amelie, A., Dai, S., Shen, X. et al. To be published.

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
3I5R 1.7 Å, PI3K SH3 domain in complex with a peptide ligand
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PBW 2.0 Å, Structure of BCR-homology (BH) domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
2IUH 2.0 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit…
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha
6PYR 2.21 Å, Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrim…

Browse structure collections

About this viewer

MolViewer shows 7RNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.