7RQQ: F10 Heavy Chain

Structure of chimeric antibody F10heavy_L9light with PfCSP peptide NANPNVDP. Determined by X-ray diffraction at 1.89 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 1.89 Å
Organisms: Homo sapiens, Plasmodium falciparum 3D7
Chains: 3
Atoms: 3,584
Mol. weight: 49.19 kDa
Released: 2 Mar 2022

Explore 7RQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RQQ contains 14 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	33-39	7	2
β-strand	45-52	8	2
β-strand	58-59	2	2
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-98	11	2
β-strand	100A-103	6	2
β-strand	107-111	5	2
α-helix	122-123	2
β-strand	124	1	3
α-helix	125-126	2
β-strand	127-131	5	4
α-helix	135-137	3
β-strand	138-139	2	4
β-strand	142-152	11	4
β-strand	153	1	3
β-strand	158-161	4	5
β-strand	171-177	7	4
β-strand	183-192	10	4
α-helix	193-195	3
β-strand	196	1	6
β-strand	199	1	6
β-strand	201-207	7	5
α-helix	208-210	3
β-strand	212-218	7	5

Chain L: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-90	7	8
β-strand	97-98	2	8
β-strand	102-107	6	8
β-strand	111	1	9
α-helix	112-113	2
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	145-150	6	11
β-strand	153-154	2	11
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-182	10	10
α-helix	183-188	6
β-strand	191-197	7	11
β-strand	205-210	6	11

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	110	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F10 Heavy Chain	H	protein	227	Homo sapiens
L9 Kappa Chain	L	protein	214	Homo sapiens
PfCSP peptide NANPNVDP	P	protein	8	Plasmodium falciparum 3D7	Q7K740 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>7RQQ_1 F10 Heavy Chain (chains H)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCHRNYYDSSGPFDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH

Sequence of entity 2 (L), FASTA

>7RQQ_2 L9 Kappa Chain (chains L)
DIQMTQSPSTLSASVGDRVTITCRASQFISRWLAWYQQKPGKAPKLLIYKASSLESGVPS
RFSGSGSETHFTLTISSLQPDDVATYYCQEYTSYGRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (P), FASTA

>7RQQ_3 PfCSP peptide NANPNVDP (chains P)
NANPNVDP

Primary citation

The light chain of the L9 antibody is critical for binding circumsporozoite protein minor repeats and preventing malaria. Wang, L.T., Hurlburt, N.K., Schon, A. et al. Cell Rep (2022) 38:110367-110367. DOI 10.1016/j.celrep.2022.110367 · PubMed

Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
6PBV 1.57 Å, Crystal structure of Fab668 complex
9NCY 1.63 Å, Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
9NI1 1.75 Å, Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
6BQB 1.77 Å, MGG4 Fab in complex with peptide

Browse structure collections

About this viewer

MolViewer shows 7RQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.