Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum. Determined by X-ray diffraction at 1.76 Å resolution. Released 16 Mar 2022.
Explore 7RXP in 3D Show helices and sheets RCSB PDB PDBe
7RXP contains 27 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 310-312 | 3 | |
| α-helix | 313-323 | 11 | |
| α-helix | 324-326 | 3 | |
| α-helix | 331-334 | 4 | |
| β-strand | 340-346 | 7 | 12 |
| α-helix | 348-350 | 3 | |
| α-helix | 355-357 | 3 | |
| α-helix | 360-363 | 4 | |
| β-strand | 364-370 | 7 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 45-51 | 7 | 8 |
| β-strand | 58-59 | 2 | 8 |
| β-strand | 67-72 | 6 | 7 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 8 |
| β-strand | 103 | 1 | 8 |
| β-strand | 107-111 | 5 | 8 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 9 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 10 |
| α-helix | 128-130 | 3 | |
| β-strand | 131-132 | 2 | 10 |
| β-strand | 135-145 | 11 | 10 |
| β-strand | 146 | 1 | 9 |
| β-strand | 151-154 | 4 | 11 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 11 |
| β-strand | 163-165 | 3 | 10 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 10 |
| β-strand | 176-185 | 10 | 10 |
| α-helix | 186-190 | 5 | |
| β-strand | 195-200 | 6 | 11 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 11 |
| α-helix | 211-214 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 4 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 145-150 | 6 | 6 |
| β-strand | 153-154 | 2 | 6 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 5 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 6 |
| β-strand | 205-210 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab1512 light chain | L | protein | 219 | Homo sapiens | |
| Fab1512 heavy chain | H | protein | 235 | Homo sapiens | |
| Circumsporozoite protein | A | protein | 67 | Plasmodium falciparum (isolate 3D7) | Q7K740 (AlphaFold model) |
>7RXP_1 Fab1512 light chain (chains L) DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGKNYLDWYLQKPGQSPQLLIYLGSDRA SGVPDRFSGSGSGTDFTLSISRVEAEDVGVYYCMQALQTPFTFGPGTKVDIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>7RXP_2 Fab1512 heavy chain (chains H) KVQLVQSGGGVVQPGRSQRLSCAASGLTLSEYAMHWVRQAPGKGLEWVAVILSDGTKKEY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCATDDNILGHCRSKSCQRNYYHGMD VWGQGTTVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>7RXP_3 Circumsporozoite protein (chains A) EEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKI CKMEKCS
A novel CSP C-terminal epitope targeted by an antibody with protective activity against Plasmodium falciparum. Beutler, N., Pholcharee, T., Oyen, D. et al. PLoS Pathog (2022) 18:e1010409-e1010409. DOI 10.1371/journal.ppat.1010409 · PubMed
Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7RXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.