7S0P: Porcine Factor VIII C2 Domain

Crystal structure of Porcine Factor VIII C2 Domain Bound to Phosphatidylserine. Determined by X-ray diffraction at 1.3 Å resolution. Released 27 Oct 2021.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Sus scrofa
Chains: 1
Atoms: 1,534
Mol. weight: 17.69 kDa
Ligands: SEP
Released: 27 Oct 2021

Explore 7S0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S0P contains 3 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain M: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2176-2177	2	1
α-helix	2187-2189	3
β-strand	2190-2192	3	1
β-strand	2197	1	2
β-strand	2202	1	2
α-helix	2205-2207	3
β-strand	2209	1	1
β-strand	2219	1	3
β-strand	2230-2246	17	1
β-strand	2248-2250	3	4
β-strand	2253-2255	3	4
β-strand	2256-2265	10	1
β-strand	2272-2273	2	1
β-strand	2275-2276	2	5
β-strand	2279-2280	2	5
α-helix	2281-2282	2
β-strand	2283-2284	2	1
β-strand	2293-2314	22	1
β-strand	2319	1	3
β-strand	2320-2326	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	M	protein	157	Sus scrofa	P12263 (AlphaFold model)

Sequence of entity 1 (M), FASTA

>7S0P_1 Coagulation factor VIII (chains M)
SCSMPLGMQNKAISDSQITASSHLSNIFATWSPSQARLHLQGRTNAWRPRVSSAEEWLQV
DLQKTVKVTGITTQGVKSLLSSMYVKEFLVSSSQDGRRWTLFLQDGHTKVFQGNQDSSTP
VVNALDPPLFTRYLRIHPTSWAQHIALRLEVLGCEAA

Ligands and cofactors

ID	Name	Formula	Copies
SEP	Phosphoserine	C3 H8 N O6 P	1

Primary citation

Stable binding to phosphatidylserine-containing membranes requires conserved arginine residues in tandem C domains of blood coagulation factor VIII. Peters, S.C., Childers, K.C., Mitchell, C.E. et al. Front Mol Biosci (2022) 9:1040106-1040106. DOI 10.3389/fmolb.2022.1040106 · PubMed

Other PDB entries of the same protein (UniProt P12263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MO3 1.7 Å, Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII
8TY1 3.46 Å, Cryo-EM structure of coagulation factor VIII bound to NB2E9
7K66 3.92 Å, Structure of Blood Coagulation Factor VIII in Complex with an Anti-C1 Domain Pathogenic…
7KBT 4.15 Å, Factor VIII in complex with the anti-C2 domain antibody, G99
8G6I 4.23 Å, Coagulation factor VIII bound to a patient-derived anti-C1 domain antibody inhibitor

Browse structure collections

About this viewer

MolViewer shows 7S0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.