7S1U: Human POT1C

Structure of human POT1C. Determined by X-ray diffraction at 2.55 Å resolution. Released 19 Jan 2022.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,912
Mol. weight: 68.9 kDa
Ligands: ZN
Released: 19 Jan 2022

Explore 7S1U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S1U contains 22 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	335-337	3	1
α-helix	344	1
β-strand	345	1	1
α-helix	348-353	6
β-strand	358-370	13	1
β-strand	378-381	4	1
β-strand	388-390	3	1
α-helix	391-393	3
α-helix	394-404	11
β-strand	419-420	2	2
β-strand	423	1	3
β-strand	435	1	3
β-strand	438-439	2	2
β-strand	441	1	4
β-strand	444	1	4
α-helix	448-450	3
β-strand	452-453	2	2
β-strand	456	1	3
α-helix	460-466	7
β-strand	472-473	2	2
β-strand	476-478	3	5
β-strand	483-485	3	5
β-strand	493-495	3	2
β-strand	498-500	3	2
β-strand	502	1	6
α-helix	512-515	4
α-helix	526-533	8
β-strand	537	1	6
β-strand	539-549	11	1
β-strand	554-561	8	1
α-helix	573-575	3
α-helix	578-590	13
β-strand	593	1	7
β-strand	595	1	7
α-helix	597-599	3
α-helix	601-602	2
β-strand	603-613	11	1
β-strand	618-625	8	1
β-strand	627-629	3	1

Chain B: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	335-337	3	8
α-helix	344	1
β-strand	345	1	8
α-helix	348-352	5
β-strand	359-370	12	8
β-strand	378-381	4	9
β-strand	388-390	3	9
α-helix	391-393	3
α-helix	394-403	10
β-strand	419-424	6	10
β-strand	428	1	11
β-strand	431	1	11
β-strand	434-439	6	10
β-strand	441	1	12
β-strand	444	1	12
β-strand	452-456	5	10
α-helix	460-466	7
β-strand	472-478	7	10
β-strand	483-485	3	10
β-strand	493-495	3	10
β-strand	498-500	3	10
β-strand	502	1	13
α-helix	512-517	6
α-helix	526-532	7
β-strand	537	1	13
β-strand	539-542	4	9
β-strand	544-549	6	8
β-strand	554-559	6	8
α-helix	577-590	14
α-helix	597-599	3
α-helix	601	1
β-strand	602-613	12	8
β-strand	618-625	8	8
β-strand	627-629	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein 1	A, B	protein	304	Homo sapiens	Q9NUX5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7S1U_1 Protection of telomeres protein 1 (chains A, B)
QLSATILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQE
VPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNE
CLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLR
SIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPA
SEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVA
EDVI

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

POT1-TPP1 binding stabilizes POT1, promoting efficient telomere maintenance. Aramburu, T., Kelich, J., Rice, C. et al. Comput Struct Biotechnol J (2022) 20:675-684. DOI 10.1016/j.csbj.2022.01.005 · PubMed

Other PDB entries of the same protein (UniProt Q9NUX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XJV 1.73 Å, Crystal structure of human POT1 bound to telomeric single-stranded DNA (TTAGGGTTAG)
3KJO 1.8 Å, Crystal Structure of hPOT1V2-dTrUd(AGGGTTAG)
3KJP 1.8 Å, Crystal Structure of hPOT1V2-GGTTAGGGTTAG
5H65 2.1 Å, Crystal structure of human POT1 and TPP1
5UN7 2.1 Å, Structure of the human POT1-TPP1 telomeric complex
8SH0 2.16 Å, Structure of human POT1 DNA binding domain bound to a 5'-phosphorylated junction of a…
7S1O 2.55 Å, Structure of human POT1C
8SH1 2.6 Å, Structure of human POT1 DNA binding domain bound to a 5'-phosphorylated junction of a…
7S1T 2.9 Å, Structure of the human POT1-TPP1 complex
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
7QXB 3.9 Å, Cryo-EM map of human telomerase-DNA-TPP1-POT1 complex (sharpened map)
7QXS 3.9 Å, Cryo-EM structure of human telomerase-DNA-TPP1-POT1 complex (with POT1 side chains)

Browse structure collections

About this viewer

MolViewer shows 7S1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.