7S3C: Intact U2AF65 RRM-region

Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide. Determined by X-ray diffraction at 1.51 Å resolution. Released 25 May 2022.

Method: X-ray diffraction
Resolution: 1.51 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,880
Mol. weight: 24.71 kDa
Released: 25 May 2022

Explore 7S3C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S3C contains 10 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	146-148	3
β-strand	150-154	5	1
α-helix	156-157	2
α-helix	162-175	14
β-strand	186-192	7	1
α-helix	193-195	3
β-strand	197-202	6	1
α-helix	205-211	7
α-helix	212-214	3
β-strand	218-219	2	2
β-strand	222-223	2	2
β-strand	225-227	3	1
α-helix	244-246	3
β-strand	251	1	3
β-strand	261-264	4	3
α-helix	272-280	9
β-strand	285-292	8	3
β-strand	299-307	9	3
α-helix	312-320	9
β-strand	324-325	2	4
β-strand	328-329	2	4
β-strand	331-334	4	3
α-helix	335-338	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A	protein	204	Homo sapiens	P26368 (AlphaFold model)
Dna/rna (5'-r(pupup(ud)papu)-d(p(bru))-r(pcpc)-3')	B	NA-hybrid	8	synthetic construct

Sequence of entity 1 (A), FASTA

>7S3C_1 Splicing factor U2AF 65 kDa subunit (chains A)
GPLGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNF
AFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDS
AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAI
AGLNGMQLGDKKLLVQRASVGAKN

Sequence of entity 2 (B), FASTA

>7S3C_2 DNA/RNA (5'-R(P*UP*UP*(UD)P*AP*U)-D(P*(BRU))-R(P*CP*C)-3') (chains B)
UUUAUUCC

Primary citation

Pre-mRNA splicing factor U2AF2 recognizes distinct conformations of nucleotide variants at the center of the pre-mRNA splice site signal. Glasser, E., Maji, D., Biancon, G. et al. Nucleic Acids Res (2022) 50:5299-5312. DOI 10.1093/nar/gkac287 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site
7SN6 1.8 Å, U2AF65 uhm bound to SF3B155 ULM5

Browse structure collections

About this viewer

MolViewer shows 7S3C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.