7SAL: LaM6 Nanobody

Crystal Structure of LaM6 Nanobody bound to mCherry. Determined by X-ray diffraction at 1.93 Å resolution. Released 14 Sept 2022.

Method: X-ray diffraction
Resolution: 1.93 Å
Organisms: Discosoma sp., Lama glama
Chains: 4
Atoms: 5,952
Mol. weight: 84.49 kDa
Released: 14 Sept 2022

Explore 7SAL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SAL contains 23 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
α-helix	144-145	2
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
α-helix	188-190	3
β-strand	193-204	12	1
β-strand	210-221	12	1

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	2
β-strand	25-36	12	2
β-strand	41-50	10	2
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
β-strand	74	1	2
α-helix	82-85	4
β-strand	91-99	9	2
β-strand	104-114	11	2
β-strand	117-127	11	2
β-strand	140-143	4	2
α-helix	144-145	2
β-strand	146-153	8	2
β-strand	156-167	12	2
β-strand	172-183	12	2
α-helix	188-190	3
β-strand	193-204	12	2
β-strand	210-220	11	2

Chain C: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	3
β-strand	10-12	3	4
β-strand	18-26	9	3
α-helix	28-29	2
β-strand	32-39	8	4
β-strand	46-51	6	4
β-strand	57-59	3	4
α-helix	61-63	3
β-strand	67-72	6	3
α-helix	73-75	3
β-strand	77-82	6	3
α-helix	87-89	3
β-strand	91-99	9	4
α-helix	100-104	5
β-strand	111-112	2	4
β-strand	116-120	5	4

Chain D: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	5
β-strand	10-12	3	6
β-strand	18-26	9	5
α-helix	28-29	2
β-strand	32-39	8	6
β-strand	46-51	6	6
β-strand	57-59	3	6
β-strand	67-72	6	5
α-helix	73-75	3
β-strand	77-82	6	5
α-helix	87-89	3
β-strand	91-99	9	6
α-helix	100-104	5
β-strand	111-112	2	6
β-strand	116-120	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mCherry	A, B	protein	237	Discosoma sp.	D1MPT3 (AlphaFold model)
LaM6	C, D	protein	142	Lama glama

Sequence of entity 1 (A, B), FASTA

>7SAL_1 mCherry (chains A, B)
SNGMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGG
PLPFAWDILSPQFXSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQ
DGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYD
AEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Sequence of entity 2 (C, D), FASTA

>7SAL_2 LaM6 (chains C, D)
MGSSHHHHHHSSGLVPRGSMAQVQLVESGGGLVQAGGSLRLSCVASGSAPSFFAMAWYRQ
SPGNERELVAALSSLGSTNYADSVKGRFTISMDNAKNTVYLQMNNVNAEDTAVYYCAAGD
FHSCYARKSCDYWGQGTQVTVS

Primary citation

High-efficiency recombinant protein purification using mCherry and YFP nanobody affinity matrices. Cong, A.T.Q., Witter, T.L., Schellenberg, M.J. Protein Sci (2022) 31:e4383-e4383. DOI 10.1002/pro.4383 · PubMed

Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NED 0.95 Å, mRouge
6MZ3 1.09 Å, mCherry pH sensitive mutant - M66T (mCherryTYG)
3LF3 1.15 Å, Crystal Structure of Fast Fluorescent Timer Fast-FT
7SAK 1.15 Å, Crystal Structure of LaM4 Nanobody bound to mCherry
31AL 1.5 Å, Synchrotron structure of non-photoactivated PAmCherry1
3KCS 1.5 Å, Crystal structure of PAmCherry1 in the dark state
9FEL 1.5 Å, LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins
6YLM 1.6 Å, mCherry
31JT 1.63 Å, SFX structure of non-photoactivated PAmCherry1
3KCT 1.65 Å, CRYSTAL STRUCTURE OF PAmCherry1 in the photoactivated state
3NEZ 1.7 Å, mRojoA
5H89 1.76 Å, Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V

Browse structure collections

About this viewer

MolViewer shows 7SAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.