1J1E: Troponin C

Crystal structure of the 52kDa domain of human cardiac troponin in the Ca2+ saturated form. Determined by X-ray diffraction at 3.3 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,860
Mol. weight: 104.22 kDa
Ligands: CA
Released: 15 Jul 2003

Explore 1J1E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J1E contains 31 α-helices and 8 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	14-27	14
β-strand	36	1	1
α-helix	38-45	8
α-helix	46-48	3
α-helix	54-62	9
β-strand	72	1	1
α-helix	74-83	10
α-helix	94-104	11
β-strand	111-113	3	2
α-helix	114-123	10
α-helix	130-140	11
β-strand	147-149	3	2
α-helix	150-157	8

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	204-221	18
α-helix	226-270	45

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	43-79	37
α-helix	85-87	3
α-helix	90-135	46
α-helix	151-159	9

Chain D: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-9	7
α-helix	14-28	15
β-strand	36	1	3
α-helix	38-47	10
α-helix	54-64	11
β-strand	72	1	3
α-helix	74-85	12
α-helix	94-104	11
β-strand	112-113	2	4
α-helix	114-123	10
α-helix	130-140	11
β-strand	147-148	2	4
α-helix	150-155	6

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	203-221	19
α-helix	226-273	48

Chain F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	43-80	38
α-helix	90-135	46
α-helix	151-159	9
α-helix	161-188	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C	A, D	protein	161	Homo sapiens	P63316 (AlphaFold model)
Troponin T	B, E	protein	106	Homo sapiens	P45379 (AlphaFold model)
Troponin I	C, F	protein	180	Homo sapiens	P19429 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>1J1E_1 Troponin C (chains A, D)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Sequence of entity 2 (B, E), FASTA

>1J1E_2 Troponin T (chains B, E)
HFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYN
LEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Sequence of entity 3 (C, F), FASTA

>1J1E_3 Troponin I (chains C, F)
MEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRAQPLELAGLGF
AELQDLARQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRIS
ADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Structure of the core domain of human cardiac troponin in the Ca2+-saturated form. Takeda, S., Yamashita, A., Maeda, K. et al. Nature (2003) 424:35-41. DOI 10.1038/nature01780 · PubMed

Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
4Y99 2.0 Å, Core domain of human cardiac troponin
1WRK 2.15 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
3RV5 2.2 Å, Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium…
7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
1WRL 2.6 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
1J1D 2.61 Å, Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form

Browse structure collections

About this viewer

MolViewer shows 1J1E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.