7SCT: Evasin P1243

Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16. Determined by X-ray diffraction at 1.84 Å resolution. Released 29 Mar 2023.

Method: X-ray diffraction
Resolution: 1.84 Å
Organisms: Amblyomma americanum, Homo sapiens
Chains: 2
Atoms: 1,248
Mol. weight: 22.57 kDa
Released: 29 Mar 2023

Explore 7SCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SCT contains 7 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
β-strand	25-27	3	1
β-strand	29	1	2
β-strand	30-31	2	3
β-strand	38	1	2
β-strand	39-40	2	3
β-strand	43-46	4	4
β-strand	49-52	4	4
α-helix	53-54	2
β-strand	58-61	4	3
α-helix	64-68	5
β-strand	76-84	9	3
β-strand	87-98	12	3

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-18	3	1
α-helix	28-30	3
β-strand	31-37	7	5
β-strand	44-49	6	5
β-strand	54-57	4	5
α-helix	62-69	8
α-helix	74	1
β-strand	75	1	5
α-helix	76-77	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P1243	A	protein	101	Amblyomma americanum	A0A0C9S461 (AlphaFold model)
C-C motif chemokine 16	B	protein	100	Homo sapiens	O15467 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SCT_1 Evasin P1243 (chains A)
GSARNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKLLGCHYFCNGTLCTAPDGYPCY
NLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP

Sequence of entity 2 (B), FASTA

>7SCT_2 C-C motif chemokine 16 (chains B)
GPSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPN
DDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Primary citation

Engineering broad-spectrum inhibitors of inflammatory chemokines from subclass A3 tick evasins. Devkota, S.R., Aryal, P., Pokhrel, R. et al. Nat Commun (2023) 14:4204-4204. DOI 10.1038/s41467-023-39879-3 · PubMed

Other PDB entries of the same protein (UniProt A0A0C9S461 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SCS 1.51 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL11
8FK6 1.74 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL7
7SCU 1.86 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7
8FK8 1.96 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7
7SCV 2.01 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8FJ3 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7(Y13A)
8SKK 2.1 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17
8FJ0 2.91 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2

Browse structure collections

About this viewer

MolViewer shows 7SCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.