7SCU: Evasin P1243

Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7. Determined by X-ray diffraction at 1.86 Å resolution. Released 5 Apr 2023.

Method: X-ray diffraction
Resolution: 1.86 Å
Organisms: Amblyomma americanum, Homo sapiens
Chains: 2
Atoms: 1,214
Mol. weight: 20.09 kDa
Released: 5 Apr 2023

Explore 7SCU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SCU contains 7 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
β-strand	25-27	3	1
β-strand	29	1	2
β-strand	30-31	2	3
β-strand	38	1	2
β-strand	39-40	2	4
β-strand	43-46	4	5
β-strand	49-52	4	5
α-helix	53-54	2
β-strand	58-61	4	4
α-helix	64-69	6
α-helix	77	1
β-strand	78-84	7	4
β-strand	87-95	9	4
β-strand	97-98	2	3

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	6
β-strand	41-45	5	6
β-strand	50-53	4	6
α-helix	58-68	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P1243	A	protein	101	Amblyomma americanum	A0A0C9S461 (AlphaFold model)
C-C motif chemokine 7	B	protein	76	Homo sapiens	P80098 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SCU_1 Evasin P1243 (chains A)
GSARNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKLLGCHYFCNGTLCTAPDGYPCY
NLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP

Sequence of entity 2 (B), FASTA

>7SCU_2 C-C motif chemokine 7 (chains B)
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWV
QDFMKHLDKKTQTPKL

Primary citation

Crystal Structure of Tick Evasin EVA-AAM1001 complexed to human chemokine CCL7. Devkota, S.R., Bhusal, R.P., Aryal, P. et al. To be published.

Other PDB entries of the same protein (UniProt A0A0C9S461 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SCS 1.51 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL11
8FK6 1.74 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL7
7SCT 1.84 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16
8FK8 1.96 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7
7SCV 2.01 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8FJ3 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7(Y13A)
8SKK 2.1 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17
8FJ0 2.91 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2

Browse structure collections

About this viewer

MolViewer shows 7SCU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.