7SRQ: 5-HT2B receptor

5-HT2B receptor bound to LSD obtained by cryo-electron microscopy (cryoEM). Determined by electron microscopy at 2.7 Å resolution. Released 21 Sept 2022.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,960
Mol. weight: 35.6 kDa
Ligands: 7LD, NAG
Released: 21 Sept 2022

Explore 7SRQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SRQ contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	57-81	25
α-helix	88-102	15
α-helix	103-107	5
α-helix	108-116	9
α-helix	127-158	32
α-helix	169-187	19
α-helix	189-192	4
α-helix	202-204	3
α-helix	216-222	7
α-helix	223-227	5
α-helix	228-241	14
α-helix	324-332	9
α-helix	334-337	4
α-helix	338-349	12
α-helix	355-381	27
α-helix	385-393	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-hydroxytryptamine receptor 2B	R	protein	311	Homo sapiens	P41595 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>7SRQ_1 5-hydroxytryptamine receptor 2B (chains R)
TESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMS
LAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIWHLCAISVDRYI
AIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKERFG
DFMLFGSLAAFFTPLAIMIVTYFLTIHALQKVRLLSGSRQTISNEQRASKVLGIVFFLFL
LMWCPFFITNITLVLCDSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRY
ITCNYRATKSV

Ligands and cofactors

ID	Name	Formula	Copies
7LD	(8alpha)-N,N-diethyl-6-methyl-9,10-didehydroergoline-8-carboxamide	C20 H25 N3 O	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Signaling snapshots of a serotonin receptor activated by the prototypical psychedelic LSD. Cao, C., Barros-Alvarez, X., Zhang, S. et al. Neuron (2022) 110:3154. DOI 10.1016/j.neuron.2022.08.006 · PubMed

Other PDB entries of the same protein (UniProt P41595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IB4 2.7 Å, Crystal structure of the chimeric protein of 5-HT2B-BRIL in complex with ergotamine
4NC3 2.8 Å, Crystal structure of the 5-HT2B receptor solved using serial femtosecond crystallography…
5TVN 2.9 Å, Crystal structure of the LSD-bound 5-HT2B receptor
7SRR 2.9 Å, 5-HT2B receptor bound to LSD in complex with heterotrimeric mini-Gq protein obtained by…
6DRY 2.92 Å, Structural Determinants of Activation and Biased Agonism at the 5-HT2B Receptor
9WNG 2.98 Å, 5HT2BR-fab heterotrimer in complex with a novel antagonist IHCH-2330
5TUD 3.0 Å, Structural Insights into the Extracellular Recognition of the Human Serotonin 2B…
6DRX 3.1 Å, Structural Determinants of Activation and Biased Agonism at the 5-HT2B Receptor
6DRZ 3.1 Å, Structural Determinants of Activation and Biased Agonism at the 5-HT2B Receptor
9WQB 3.18 Å, 5-HT2B receptor bound to IHCH-6122 in complex with an antibody obtained by cryo-electron…
6DS0 3.19 Å, Structural Determinants of Activation and Biased Agonism at the 5-HT2B Receptor
9WQA 3.28 Å, 5-HT2B receptor bound to IHCH-1906 in complex with an antibody obtained by cryo-electron…

Browse structure collections

About this viewer

MolViewer shows 7SRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.