4IB4: Chimeric protein of 5-HT2B-BRIL

Crystal structure of the chimeric protein of 5-HT2B-BRIL in complex with ergotamine. Determined by X-ray diffraction at 2.7 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 3,064
Mol. weight: 51.71 kDa
Ligands: OLC, OLB, OLA, CLR
Released: 13 Mar 2013

Explore 4IB4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IB4 contains 21 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	54-60	7
α-helix	61-65	5
α-helix	66-81	16
α-helix	83-85	3
α-helix	88-102	15
α-helix	103-107	5
α-helix	108-111	4
α-helix	113-116	4
α-helix	127-158	32
α-helix	165-187	23
α-helix	189-193	5
α-helix	211-222	12
α-helix	223-227	5
α-helix	228-1019	40
α-helix	1023-1036	14
α-helix	1038-1041	4
α-helix	1060-1081	22
α-helix	1084-1092	9
α-helix	1095-349	48
α-helix	355-381	27
α-helix	385-394	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562	A	protein	430	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P41595 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4IB4_1 Chimera protein of human 5-hydroxytryptamine receptor 2B and E. Coli soluble cytochrome b562 (chains A)
DYKDDDDGAPTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKL
QYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIWH
LCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNI
TCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAADLEDNWETLNDNLKVI
EKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALK
LANEGKVKEAQAAAEQLKTTRNAYIQKYLQTISNEQRASKVLGIVFFLFLLMWCPFFITN
ITLVLCDSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKS
VGRPLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	1
OLB	(2S)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	3
OLA	Oleic acid	C18 H34 O2	2
CLR	Cholesterol	C27 H46 O	1
PLM	Palmitic acid	C16 H32 O2	1
ERM	Ergotamine	C33 H35 N5 O5	1

Water and common crystallization additives (PEG) are not listed.

Primary citation

Structural features for functional selectivity at serotonin receptors. Wacker, D., Wang, C., Katritch, V. et al. Science (2013) 340:615-619. DOI 10.1126/science.1232808 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse more

4IB4 is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 4IB4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.