Crystal Structure of Ebola zaire Envelope glycoprotein GP in complex with compound ARN0075093. Determined by X-ray diffraction at 2.5 Å resolution. Released 9 Aug 2023.
Explore 7SSR in 3D Show helices and sheets RCSB PDB PDBe
7SSR contains 11 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 1 |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 60-62 | 3 | |
| β-strand | 63-69 | 7 | 1 |
| α-helix | 70-73 | 4 | |
| α-helix | 79-83 | 5 | |
| β-strand | 86-89 | 4 | 2 |
| β-strand | 96-98 | 3 | 1 |
| β-strand | 101 | 1 | 1 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 105-114 | 10 | 4 |
| β-strand | 120 | 1 | 4 |
| α-helix | 123 | 1 | |
| β-strand | 124 | 1 | 5 |
| α-helix | 125-126 | 2 | |
| β-strand | 135-144 | 10 | 4 |
| β-strand | 151-154 | 4 | 2 |
| β-strand | 159-161 | 3 | 1 |
| β-strand | 165-167 | 3 | 1 |
| β-strand | 169 | 1 | 2 |
| β-strand | 172 | 1 | 5 |
| β-strand | 176 | 1 | 4 |
| β-strand | 177-185 | 9 | 1 |
| β-strand | 216-223 | 8 | 4 |
| β-strand | 231-237 | 7 | 4 |
| β-strand | 240-243 | 4 | 4 |
| α-helix | 250-262 | 13 | |
| β-strand | 273-275 | 3 | 4 |
| β-strand | 277 | 1 | 6 |
| β-strand | 355 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 503 | 1 | 1 |
| β-strand | 515-519 | 5 | 3 |
| α-helix | 539-541 | 3 | |
| β-strand | 544-548 | 5 | 3 |
| α-helix | 551-553 | 3 | |
| α-helix | 554-575 | 22 | |
| β-strand | 580-581 | 2 | 1 |
| α-helix | 584-597 | 14 | |
| α-helix | 613-625 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GP1 | A | protein | 329 | Zaire ebolavirus | Q05320 (AlphaFold model) |
| GP2 | B | protein | 168 | Zaire ebolavirus | Q05320 (AlphaFold model) |
>7SSR_1 GP1 (chains A) ETGRSIPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWG FRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPC AGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATE DPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRS NTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSTHHQDTGEESASSGK LGLITNTIAGVAGLITGGRRTRRXXXXXX
>7SSR_2 GP2 (chains B) EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQL ANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPADWTKNITD KIDQIIHDFVDGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGTHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZTL | (1R,2s,3S,5s,7s)-N-[(1r,4r)-4-(aminomethyl)cyclohexyl]-5-phenyladamantane-2-car… | C24 H34 N2 O | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
Water and common crystallization additives (ACT, EDO) are not listed.
Crystal Structure of Ebola zaire Envelope glycoprotein GP in complex with compound ARN0075093. Abendroth, J., Lorimer, D.D., Horanyi, P.S. et al. To be published.
Other PDB entries of the same protein (UniProt Q05320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7SSR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.