Structure of the Fbw7-Skp1-MycCdegron complex. Determined by X-ray diffraction at 2.55 Å resolution. Released 16 Feb 2022.
Explore 7T1Y in 3D Show helices and sheets RCSB PDB PDBe
7T1Y contains 21 α-helices and 35 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| β-strand | 13-17 | 5 | 1 |
| α-helix | 18-21 | 4 | |
| α-helix | 25-29 | 5 | |
| α-helix | 30-34 | 5 | |
| β-strand | 46-47 | 2 | 1 |
| α-helix | 52-63 | 12 | |
| α-helix | 87-92 | 6 | |
| α-helix | 97-110 | 14 | |
| α-helix | 113-128 | 16 | |
| α-helix | 132-139 | 8 | |
| α-helix | 147-156 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 264-272 | 9 | |
| α-helix | 274-276 | 3 | |
| α-helix | 280-283 | 4 | |
| α-helix | 286-293 | 8 | |
| α-helix | 298-304 | 7 | |
| α-helix | 309-314 | 6 | |
| α-helix | 318-327 | 10 | |
| α-helix | 350-367 | 18 | |
| α-helix | 371-373 | 3 | |
| β-strand | 374-377 | 4 | 2 |
| β-strand | 384-390 | 7 | 3 |
| β-strand | 393-398 | 6 | 3 |
| β-strand | 403-407 | 5 | 3 |
| β-strand | 413-417 | 5 | 3 |
| β-strand | 424-429 | 6 | 4 |
| β-strand | 433-438 | 6 | 4 |
| β-strand | 443-447 | 5 | 4 |
| β-strand | 452-457 | 6 | 4 |
| β-strand | 464-469 | 6 | 5 |
| β-strand | 473-478 | 6 | 5 |
| β-strand | 482-487 | 6 | 5 |
| β-strand | 493-498 | 6 | 5 |
| α-helix | 503 | 1 | |
| β-strand | 504-509 | 6 | 6 |
| β-strand | 514-518 | 5 | 6 |
| β-strand | 522-527 | 6 | 6 |
| β-strand | 532-538 | 7 | 6 |
| β-strand | 544-549 | 6 | 7 |
| β-strand | 553-558 | 6 | 7 |
| β-strand | 563-567 | 5 | 7 |
| β-strand | 573-577 | 5 | 7 |
| β-strand | 584-590 | 7 | 8 |
| β-strand | 593-598 | 6 | 8 |
| β-strand | 603-607 | 5 | 8 |
| β-strand | 613-617 | 5 | 8 |
| β-strand | 627-632 | 6 | 9 |
| β-strand | 636-641 | 6 | 9 |
| β-strand | 645-650 | 6 | 9 |
| β-strand | 656-662 | 7 | 9 |
| α-helix | 666-668 | 3 | |
| β-strand | 671-677 | 7 | 2 |
| β-strand | 681-687 | 7 | 2 |
| β-strand | 696-701 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 245-247 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| S-phase kinase-associated protein 1 | A | protein | 156 | Homo sapiens | P63208 (AlphaFold model) |
| F-box/WD repeat-containing protein 7 | B | protein | 457 | Homo sapiens | Q969H0 (AlphaFold model) |
| Myc proto-oncogene protein C terminal degron | C | protein | 30 | Homo sapiens | P01106 (AlphaFold model) |
>7T1Y_1 S-phase kinase-associated protein 1 (chains A) MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDVPLPNVNAAILKKVIQWCTHHKD DPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMI KGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
>7T1Y_2 F-box/WD repeat-containing protein 7 (chains B) SHHHHHHGGSGMTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRY WRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGEL KSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR DNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIET GQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD GIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKT GQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGG VVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
>7T1Y_3 Myc proto-oncogene protein C terminal degron (chains C) PEPLVLHEETPPTTSSDSEEEQEDEEIDVV
Two diphosphorylated degrons control c-Myc degradation by the Fbw7 tumor suppressor. Welcker, M., Wang, B., Rusnac, D.V. et al. Sci Adv (2022) 8:eabl7872-eabl7872. DOI 10.1126/sciadv.abl7872 · PubMed
Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7T1Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.